Detailed information of effector


Summary

Effector ID EFF01466 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00005 experimental (Type i4a)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (179 a.a.); Nucleotide sequence (537 bp)
Description TseF facilitates the delivery of OMV-associated iron to bacterial cells by engaging the Fe (III)-pyochelin receptor FptA and the porin OprF
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2374
Coordinates (Strand) 2626221..2626757 (+)
NCBI ID 15597570
RefSeq NC_002516
Uniprot ID Q9I1A5_PSEAE
KEGG ID pae:PA2374
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-178 MAASGKLDLVRGDSHLAGNLLDGSLEGPLRIDEHDRPQASLGYRQGQLHGASTLFHPNGKVSAQLAFVDGKLHGPASFHAAEGWLQRKAHYRNGLLHGEAFNYFANGQVAEREHYRDGVRDGVYQRFHGNGQLAFDGRYLNGQLLDGAQPFADDGRPLDSEGKPMARWRWWWTRLAEP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9907 - -



  Protein sequence: 179 a.a.    .

>EFF01466 NC_002516:2626221-2626757 [Pseudomonas aeruginosa PAO1]
MAASGKLDLVRGDSHLAGNLLDGSLEGPLRIDEHDRPQASLGYRQGQLHGASTLFHPNGKVSAQLAFVDGKLHGPASFHA
AEGWLQRKAHYRNGLLHGEAFNYFANGQVAEREHYRDGVRDGVYQRFHGNGQLAFDGRYLNGQLLDGAQPFADDGRPLDS
EGKPMARWRWWWTRLAEP*

  Nucleotide sequence: 537 bp    .

>EFF01466 NC_002516:2626221-2626757 [Pseudomonas aeruginosa PAO1]
ATGGCGGCATCCGGCAAGCTCGACCTGGTTCGTGGCGACAGCCATCTCGCCGGCAACCTGCTCGACGGCAGCCTGGAAGG
CCCGTTGCGCATCGACGAGCACGACAGGCCGCAGGCCAGCCTCGGCTACCGGCAGGGCCAGTTGCACGGCGCCAGCACCC
TGTTCCATCCCAACGGCAAGGTCTCCGCGCAACTCGCCTTCGTCGACGGCAAGCTGCACGGGCCGGCGAGTTTCCATGCC
GCGGAAGGCTGGTTGCAGCGCAAGGCGCACTACCGCAACGGGCTGCTCCACGGCGAAGCGTTCAACTATTTCGCCAACGG
CCAGGTGGCCGAGCGCGAGCATTACCGCGACGGCGTGCGCGACGGGGTCTACCAGCGCTTCCATGGCAATGGCCAACTGG
CCTTCGACGGACGCTACCTGAACGGCCAGCTACTGGACGGCGCCCAGCCGTTCGCCGACGACGGCCGGCCGCTGGACAGC
GAGGGCAAGCCCATGGCGCGCTGGCGCTGGTGGTGGACCAGGCTGGCGGAGCCCTAG