Detailed information of effector


Summary

Effector ID EFF01462 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (118 a.a.); Nucleotide sequence (354 bp)
Description Zn2+-binding protein substrate YezP has the capacity to rescue the sensitivity to oxidative stress exhibited by T6SS-4 mutants when added to extracellular milieu.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_RS17835
Coordinates (Strand) 3905334..3905687 (-)
NCBI ID 169752298
RefSeq NC_010465
Uniprot ID A0A0H3B7J5_YERPY
KEGG ID ypy:YPK_3549
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6277 PF19793.1 2.8e-53 1..117

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-117 MLDPKNIQNVLKSSTDLGQQSQSDLQKPFVKGMQNMEMSGADAARSIMQSVNQSCETMMSDMNKILGGLQDNVDAHQKMQSEERPKDFERAMSDLRSTLSNGFPEEMKSMFDKLPKM



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9656 - -



  Protein sequence: 118 a.a.    .

>EFF01462 NC_010465:c3905687-3905334 [Yersinia pseudotuberculosis YPIII]
MLDPKNIQNVLKSSTDLGQQSQSDLQKPFVKGMQNMEMSGADAARSIMQSVNQSCETMMSDMNKILGGLQDNVDAHQKMQ
SEERPKDFERAMSDLRSTLSNGFPEEMKSMFDKLPKM*

  Nucleotide sequence: 354 bp    .

>EFF01462 NC_010465:c3905687-3905334 [Yersinia pseudotuberculosis YPIII]
ATGCTAGATCCTAAAAACATCCAGAATGTATTGAAGTCATCTACTGACCTTGGTCAGCAATCTCAATCTGATTTGCAGAA
ACCTTTTGTAAAAGGAATGCAAAATATGGAGATGTCAGGGGCCGATGCCGCTCGCAGTATCATGCAATCGGTTAATCAAT
CCTGCGAAACCATGATGAGCGATATGAATAAGATATTGGGAGGATTGCAGGACAATGTTGATGCTCACCAGAAAATGCAA
AGTGAGGAGCGTCCGAAGGACTTCGAGAGAGCCATGAGTGATCTTCGCAGCACACTCTCCAATGGTTTCCCAGAGGAAAT
GAAAAGTATGTTTGATAAATTGCCCAAAATGTAG