Detailed information of effector


Summary

Effector ID EFF01461 experimental
Effector type Tpe
Cognate immunity protein -
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (719 a.a.); Nucleotide sequence (2157 bp)
Description V12G01_01435 is predicted to contain an N-terminal LysM peptidoglycan-binding domain followed by a peptidoglycan (PG) hydrolase domain and a lysozyme-like domain
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_RS25410
Coordinates (Strand) 98312..100468 (-)
NCBI ID 491515716
RefSeq NZ_CH902589
Uniprot ID A0A0P7ENS9_VIBAL
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-718 MDAVFPIAQREGDAYYTLSDFTKLFDQAKSGRYLIGQGYGWHSGIHLTSKMLPWGKGLRPIQAMLDGKIVAFRINPDYLTSTYQEQEFKYSNNFVLIEHEAVNPEDNEDVFKFYTLYMHLAPPSDIGANSSITTRYRLQEARNVRTFKHSDVPTNSGEKKQSMSKGTLLEYLYAEEKETHPYQIDKNTYKMIKCRVVENGKSASGSEKALLNKIVWFASGLNSDFDILEDSSAVLSEPVSEPKWMSDKAAMIRDGSVVSLLPLLFREGIKVSAGEDIGYMGLHEYSNDAIGTKKEDNRVHIEMFSFEEPPEFFKKQISPKNAEENPLVVLDGADSSGAVDMSNSFIQQLLESVTEDQVTDFSSFTARDAKVYLDGKRKHFERFIVKHPTDWHTESSQSLYESIHQTAKEALDIKCSAGFVTIEDYRNSPWRDQVMDSFDLFSQFELERADKFSWMQDLHGDLQLSDDKSLWHYWPFVGNHTQSKCFCNRDISKSFLLEVLGGKETIFENSHYDSMRNVSLDELLNSLNDMFRTYEIDDCLNKIHFLSQAFQESDFFKTTEEYYYNGKYPEKWNKYRGGAFYHGRGLLQITHIENYAKYFGVNTKDLTKEMIESVAKDLHTAVDSSGWFWVKGSAWGDIRPFATKNDLFRVTISVNGGYNHLLERKNNLLKLSKLINCNSISDNYDFSKFYLKDSSMINKNYYKRSKSVHHKLELMINE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9865 - -



  Protein sequence: 719 a.a.    .

>EFF01461 NZ_CH902589:c100468-98312 [Vibrio alginolyticus 12G01]
MDAVFPIAQREGDAYYTLSDFTKLFDQAKSGRYLIGQGYGWHSGIHLTSKMLPWGKGLRPIQAMLDGKIVAFRINPDYLT
STYQEQEFKYSNNFVLIEHEAVNPEDNEDVFKFYTLYMHLAPPSDIGANSSITTRYRLQEARNVRTFKHSDVPTNSGEKK
QSMSKGTLLEYLYAEEKETHPYQIDKNTYKMIKCRVVENGKSASGSEKALLNKIVWFASGLNSDFDILEDSSAVLSEPVS
EPKWMSDKAAMIRDGSVVSLLPLLFREGIKVSAGEDIGYMGLHEYSNDAIGTKKEDNRVHIEMFSFEEPPEFFKKQISPK
NAEENPLVVLDGADSSGAVDMSNSFIQQLLESVTEDQVTDFSSFTARDAKVYLDGKRKHFERFIVKHPTDWHTESSQSLY
ESIHQTAKEALDIKCSAGFVTIEDYRNSPWRDQVMDSFDLFSQFELERADKFSWMQDLHGDLQLSDDKSLWHYWPFVGNH
TQSKCFCNRDISKSFLLEVLGGKETIFENSHYDSMRNVSLDELLNSLNDMFRTYEIDDCLNKIHFLSQAFQESDFFKTTE
EYYYNGKYPEKWNKYRGGAFYHGRGLLQITHIENYAKYFGVNTKDLTKEMIESVAKDLHTAVDSSGWFWVKGSAWGDIRP
FATKNDLFRVTISVNGGYNHLLERKNNLLKLSKLINCNSISDNYDFSKFYLKDSSMINKNYYKRSKSVHHKLELMINE*

  Nucleotide sequence: 2157 bp    .

>EFF01461 NZ_CH902589:c100468-98312 [Vibrio alginolyticus 12G01]
ATGGATGCAGTTTTTCCGATAGCGCAACGAGAAGGTGACGCTTACTACACGCTCAGTGATTTTACGAAATTGTTTGATCA
AGCTAAGAGCGGTCGTTATTTAATAGGACAAGGGTACGGTTGGCATAGTGGCATTCACTTAACATCAAAAATGTTACCGT
GGGGGAAAGGGCTCAGACCTATTCAAGCGATGCTTGATGGAAAAATAGTGGCATTTCGCATAAATCCTGATTACCTAACA
TCAACGTACCAAGAGCAAGAGTTTAAGTATAGTAATAACTTTGTGCTTATCGAGCATGAGGCTGTAAACCCCGAAGATAA
TGAAGATGTATTTAAGTTCTATACACTTTATATGCACCTTGCGCCACCTTCAGATATTGGCGCCAATTCATCTATAACCA
CGCGTTACCGTTTACAAGAAGCGAGAAATGTACGCACTTTCAAACATAGTGATGTGCCTACTAATTCTGGTGAAAAAAAA
CAGTCGATGTCTAAAGGAACATTACTTGAATACCTGTATGCAGAAGAGAAGGAGACCCATCCATACCAGATCGACAAAAA
TACCTACAAAATGATAAAGTGCCGTGTGGTAGAGAATGGTAAATCGGCAAGTGGTAGCGAAAAAGCACTGTTAAACAAGA
TTGTTTGGTTTGCTTCGGGTCTCAATAGTGACTTTGACATTTTAGAAGATTCCTCTGCTGTCCTATCAGAACCAGTTTCA
GAACCTAAATGGATGTCGGACAAGGCGGCAATGATTAGGGACGGTAGTGTGGTTTCTTTACTCCCACTCCTATTTAGAGA
GGGGATAAAGGTTTCAGCTGGGGAAGATATCGGTTACATGGGACTGCATGAGTACAGTAACGATGCAATTGGAACTAAGA
AAGAAGATAATCGTGTGCATATCGAGATGTTCTCTTTTGAGGAGCCGCCCGAATTTTTCAAAAAACAGATTTCTCCCAAA
AATGCGGAAGAAAATCCACTTGTTGTTCTCGATGGGGCCGATAGTAGCGGTGCCGTTGATATGAGTAATTCGTTTATTCA
GCAATTACTTGAATCTGTGACAGAAGATCAAGTAACGGACTTCTCCTCGTTCACTGCTCGCGATGCCAAAGTATACTTAG
ACGGTAAGCGTAAACACTTTGAGCGATTTATTGTGAAACATCCTACAGATTGGCATACAGAGTCGTCACAAAGTCTTTAT
GAATCAATCCATCAGACCGCAAAGGAAGCTCTAGATATTAAGTGCTCCGCTGGTTTTGTGACTATAGAGGACTACCGTAA
CTCCCCATGGCGCGATCAAGTGATGGATAGCTTTGATCTTTTCTCGCAATTCGAACTGGAAAGAGCAGATAAGTTTTCAT
GGATGCAAGATTTACATGGTGATTTGCAACTAAGCGATGATAAGAGCCTTTGGCATTATTGGCCTTTTGTAGGAAATCAC
ACCCAAAGTAAATGTTTCTGTAATCGTGATATTTCCAAGAGTTTTTTACTTGAAGTCTTAGGTGGAAAAGAAACTATTTT
TGAGAACTCTCATTATGACAGTATGAGAAATGTTTCTTTAGATGAGTTATTAAATAGCTTGAATGACATGTTTAGGACGT
ATGAAATCGATGATTGTTTGAATAAAATCCACTTTCTGTCTCAAGCATTTCAAGAAAGTGATTTTTTCAAAACGACGGAA
GAGTACTATTATAACGGGAAATATCCAGAGAAATGGAATAAGTACAGAGGTGGTGCATTCTATCATGGACGTGGTTTATT
ACAGATAACACATATAGAAAACTATGCTAAATACTTTGGTGTGAATACTAAAGATCTTACAAAAGAAATGATAGAAAGCG
TTGCTAAAGATTTACACACGGCAGTAGATTCTTCAGGGTGGTTTTGGGTAAAAGGTAGTGCTTGGGGAGATATTCGTCCA
TTCGCTACCAAGAATGATCTATTTCGTGTAACGATCTCAGTAAATGGTGGTTACAATCATTTGTTAGAGAGAAAAAATAA
CTTATTAAAACTTTCAAAGTTGATTAATTGTAATTCAATATCCGATAACTATGACTTTAGTAAGTTTTATCTTAAGGATA
GTTCAATGATCAATAAAAATTACTATAAAAGAAGTAAGAGTGTACATCACAAGCTGGAGTTAATGATAAATGAATAA