Detailed information of effector


Summary

Effector ID EFF01460 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (584 a.a.); Nucleotide sequence (1752 bp)
Description V12G01_01565 contains a MIX motif belonging to the MIX I clan
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_RS25535
Coordinates (Strand) 138873..140624 (-)
NCBI ID 491515792
RefSeq NZ_CH902589
Uniprot ID UPI0000D545D0
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-583 MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRLRNSDDILRNLPKELAQKISISAKNTTSALLAAIRIELGKGNWVSLSTVARRSPLTDSQLQSFPRLKSLVDSVSASNESKAFKAGYKQVTDDVALVRSYTHVPSEPSPDQKIVVEFAGQWSSNAACLMLGKTEAQKEKVTVGKADTENKHRSLAIFKDLEAEGKTLYIKIPCTDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVVPLHFPGSDKSDEAAEVFKSGYVYVVWNNKIWREVAITENGYFSDTDINSVREGSRPKRHADIYMTNPETGGVFAYEPFQIVQNGKVVSEGSLNGSGEARVFNLVEEEVEIVMTGYEPQIKEKIETNLSPINASSPVERSAQGYPLPHIWLPYKIKGEPQEVYLAYNSKRLSESELSQLESDPGTKAIKVTDLNHYSSEKSFKIGDGSVRLLSVLPSAATSKPEKYAMLRSQLNKNVAVVYLLKSVEIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCIKKENGSRLIRFTGWPAEVKEVDLLRGYQGNSHHGRDNKTVIFAQTPIADLLAYKKKDQPS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9898 - -



  Protein sequence: 584 a.a.    .

>EFF01460 NZ_CH902589:c140624-138873 [Vibrio alginolyticus 12G01]
MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRLRNSDDILRNLPKELAQKISISAKNTTSALLAAIRIELGKGNWVSLS
TVARRSPLTDSQLQSFPRLKSLVDSVSASNESKAFKAGYKQVTDDVALVRSYTHVPSEPSPDQKIVVEFAGQWSSNAACL
MLGKTEAQKEKVTVGKADTENKHRSLAIFKDLEAEGKTLYIKIPCTDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVV
PLHFPGSDKSDEAAEVFKSGYVYVVWNNKIWREVAITENGYFSDTDINSVREGSRPKRHADIYMTNPETGGVFAYEPFQI
VQNGKVVSEGSLNGSGEARVFNLVEEEVEIVMTGYEPQIKEKIETNLSPINASSPVERSAQGYPLPHIWLPYKIKGEPQE
VYLAYNSKRLSESELSQLESDPGTKAIKVTDLNHYSSEKSFKIGDGSVRLLSVLPSAATSKPEKYAMLRSQLNKNVAVVY
LLKSVEIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCIKKENGSRLIRFTGWPAEVKEVDLLRGYQGNSHHGRDN
KTVIFAQTPIADLLAYKKKDQPS*

  Nucleotide sequence: 1752 bp    .

>EFF01460 NZ_CH902589:c140624-138873 [Vibrio alginolyticus 12G01]
ATGCATTTAGTTTGCAAATTTATACCTAGCTCGAAGCTATCCTCCAACGAGCTATCTTATGTTCTTACACCGGACGAGTG
TATAGGACAGCTTTCGCGTTTGCGAAATTCAGATGACATCCTTAGAAACCTCCCTAAAGAATTGGCGCAAAAGATTTCCA
TCTCTGCCAAAAACACGACCAGCGCATTGCTAGCTGCGATAAGAATCGAATTGGGGAAAGGCAATTGGGTGTCATTATCT
ACCGTTGCTCGTCGTTCGCCATTGACGGACTCTCAGCTGCAAAGCTTCCCTAGACTTAAATCACTCGTTGACTCTGTATC
TGCTTCGAATGAAAGCAAAGCTTTTAAAGCAGGATACAAGCAGGTTACCGACGATGTTGCTTTAGTTCGTAGTTACACGC
ATGTCCCCTCTGAGCCAAGCCCAGATCAAAAAATCGTTGTCGAGTTTGCAGGGCAGTGGTCTAGCAACGCGGCATGTTTG
ATGTTGGGAAAAACCGAAGCTCAAAAAGAAAAAGTGACTGTAGGCAAGGCTGATACAGAAAACAAACACCGCAGCCTCGC
GATATTTAAAGATCTCGAAGCTGAGGGCAAAACGCTCTATATCAAAATCCCTTGCACTGACCAGCCTCAGCCAATTTTGC
TTAAACTCGCCGAAGACCTGCAACCCGTTGATAAAGAAACTCAAATGGATGAGTGGGATAACGTGTTGGTGCCTGTGGTT
CCGCTGCACTTCCCTGGTAGCGATAAATCAGATGAAGCTGCAGAAGTGTTTAAATCAGGCTACGTGTATGTTGTTTGGAA
CAATAAAATTTGGCGCGAAGTGGCAATTACGGAAAATGGTTACTTTTCAGATACGGACATTAATAGTGTTCGTGAAGGCT
CTAGACCCAAAAGGCACGCCGATATCTATATGACCAATCCTGAAACAGGCGGTGTTTTCGCTTATGAGCCTTTCCAAATC
GTGCAGAACGGCAAGGTGGTAAGTGAAGGCTCTTTGAATGGCTCTGGAGAGGCTCGAGTGTTCAACTTAGTTGAGGAAGA
AGTTGAGATAGTCATGACAGGCTATGAGCCACAAATCAAAGAAAAGATTGAAACAAATTTGAGCCCTATTAATGCTTCTA
GCCCAGTGGAGCGGAGCGCGCAAGGTTACCCTCTCCCGCATATATGGCTTCCTTACAAGATTAAAGGTGAGCCTCAAGAA
GTATATTTGGCTTATAACAGTAAACGATTGAGCGAGAGTGAACTATCTCAACTAGAAAGTGATCCCGGAACCAAGGCCAT
AAAAGTCACTGATCTTAACCATTATAGCAGTGAGAAAAGCTTTAAAATTGGAGACGGTTCTGTTCGTCTGCTCTCAGTAT
TACCAAGTGCTGCGACCTCAAAACCTGAAAAATACGCAATGTTACGAAGCCAGCTAAATAAAAATGTAGCGGTCGTGTAT
TTACTTAAATCTGTCGAGATAGTTTTCGAATATCCGGGCTATACGACGCTGGACGAGTCAGATGATTACTTTGAGTTAAG
GCAAAGCGATGGTGATTGGTCGCAGCGAGTGTGCTTGCGCCAATGTATAAAAAAAGAGAATGGTTCTAGGTTGATTCGTT
TTACTGGTTGGCCTGCAGAGGTTAAAGAAGTGGATCTTCTCCGTGGTTATCAGGGCAATAGTCATCACGGAAGAGATAAT
AAAACGGTCATTTTTGCTCAAACACCCATTGCGGATTTACTGGCTTATAAGAAAAAAGATCAGCCAAGTTAA