Detailed information of effector


Summary

Effector ID EFF01380 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS00553 insolico (Type i3)
Strain Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
Replicon chromosome
Sequence Protein sequence (162 a.a.); Nucleotide sequence (486 bp)
Description Tae4
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Benz J, Reinstein J, Meinhart A. Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium. PLoS One. 2013 Jun 27;8(6):e67362. doi: 10.1371/journal.pone.0067362. Print 2013. PMID: 23826277
[3] Ma J, Sun M, Dong W, et al. PAAR-Rhs proteins harbor various C-terminal toxins to diversify the antibacterial pathways of type VI secretion systems. Environ Microbiol. 2017 Jan;19(1):345-360. doi: 10.1111/1462-2920.13621. Epub 2017 Jan 18. PMID: 27871130
[4] Sana TG, Flaugnatti N, Lugo KA, et al. Salmonella Typhimurium utilizes a T6SS-mediated antibacterial weapon to establish in the host gut. Proc Natl Acad Sci U S A. 2016 Aug 23;113(34):E5044-51. doi: 10.1073/pnas.1608858113. Epub 2016 Aug 8. PMID: 27503894
[5] Sana TG, Flaugnatti N, Lugo KA, et al. Salmonella Typhimurium utilizes a T6SS-mediated antibacterial weapon to establish in the host gut. Proc Natl Acad Sci U S A. 2016 Aug 23;113(34):E5044-51. doi: 10.1073/pnas.1608858113. Epub 2016 Aug 8. PMID: 27503894
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) STM0277 (Tae4)
Coordinates (Strand) 317684..318169 (+)
NCBI ID 378698249
RefSeq NC_016860
Uniprot ID UPI00000D020F
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 2.1e-22 41..137

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-161 MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWILP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8623 - -



  Protein sequence: 162 a.a.    .

>EFF01380 NC_016860:317684-318169 [Salmonella enterica subsp. enterica serovar Typhimurium str.]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRV
NDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWIL
P*

  Nucleotide sequence: 486 bp    .

>EFF01380 NC_016860:317684-318169 [Salmonella enterica subsp. enterica serovar Typhimurium str.]
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGGGTAGCATTAT
TGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCGAATGAGCTATGTTTTGAATG
CGACAGGGTTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGTGCCGATAATAAATTCTATATTTATCGCGTG
AATGATATGATTGATTATCTTACTCATACTATGGGCAAGCCTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTAT
CGGGAAGAAAGGAATTATCGTAGTAAAAGGGCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTA
TCTGTTCAGATCAGTGCCACTTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACACTGTGGATACTG
CCGTGA