Detailed information of effector


Summary

Effector ID EFF01313 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00127 experimental (Type i1)
Strain Myxococcus xanthus DK 1622
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) MXAN_4809 (hcp)
Coordinates (Strand) 6018067..6018558 (+)
NCBI ID 108762846
RefSeq NC_008095
Uniprot ID UPI00004FE5DA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.9e-25 8..147

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MAESVHLYLKANGSDIKGDSTQTSLGRADSIECVAYSQKVFTAREAGSGLATGRRQYEGIEITKRIDKSSPLLMKALCENQVIDATFKFFRPNPTGDGTTEQFYTVSIKKARINAIQQTVPNSFVPASTNLPPMETLQLVFHTINWTITQGGVTHEDTWDTQR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9871 - -



  Protein sequence: 164 a.a.    .

>EFF01313 NC_008095:6018067-6018558 [Myxococcus xanthus DK 1622]
MAESVHLYLKANGSDIKGDSTQTSLGRADSIECVAYSQKVFTAREAGSGLATGRRQYEGIEITKRIDKSSPLLMKALCEN
QVIDATFKFFRPNPTGDGTTEQFYTVSIKKARINAIQQTVPNSFVPASTNLPPMETLQLVFHTINWTITQGGVTHEDTWD
TQR*

  Nucleotide sequence: 492 bp    .

>EFF01313 NC_008095:6018067-6018558 [Myxococcus xanthus DK 1622]
ATGGCTGAATCAGTACACCTGTACCTGAAGGCGAACGGCAGCGACATCAAGGGCGACAGCACGCAGACCAGCCTGGGCCG
CGCGGACTCCATCGAGTGCGTCGCGTACAGCCAGAAGGTCTTCACCGCTCGCGAGGCCGGTTCGGGTCTGGCGACGGGCC
GCCGCCAGTACGAGGGCATCGAAATCACCAAGCGCATCGACAAGTCGTCGCCGCTGCTGATGAAGGCCCTCTGCGAGAAC
CAGGTCATCGACGCGACCTTCAAGTTCTTCCGTCCGAACCCGACGGGCGACGGCACCACCGAGCAGTTCTACACGGTGTC
CATCAAGAAGGCCCGCATCAACGCCATCCAACAGACGGTGCCGAACTCCTTCGTGCCGGCGAGCACCAACCTGCCCCCGA
TGGAGACCCTCCAGCTGGTGTTCCACACCATCAACTGGACCATCACCCAGGGCGGCGTTACGCACGAGGACACCTGGGAC
ACCCAGCGTTGA