Detailed information of effector


Summary

Effector ID EFF01312 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00910 experimental (Type iii)
Strain Flavobacterium johnsoniae UW101
Replicon chromosome
Sequence Protein sequence (911 a.a.); Nucleotide sequence (2733 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) FJOH_RS16975
Coordinates (Strand) 3912310..3915042 (-)
NCBI ID 146301018
RefSeq NC_009441
Uniprot ID UPI00006E8C6E
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-910 MSDFKIIGNPDPVVGKEEFYSVNTFLPSILPFQNSASSNSFEQPVKWEIYILENGRWRKTKENDKTGKRISYTFLQKSLERKGIRILARRGEDVARLNVTTHPAEKPKIESIELLDKNGQKPGKPLSYGQTLKARVHCLHMEKHKVSVTLWEDDAIGAGHNKANENNLIQTLSGVVANGKADVDFLLRPSFAKIAKQNGPEEGKIHEYYVTVDFNKDKIASNNVNVNDLEAPVAPFKGKVPVQQQAPAKPKASLPQPTQPKTKAPATGSSSAPKVKAEITRVHITNSAKQPIKGTHKEKEIIVWVDSQGLIGKEIRFKLYDEDYLSNDLLVDQKFKITGDIFPITVQLDRILRSKGGISGEGAEQELFADVEVIQTSIHSKSEVVDVDAKVFKPDPVDSTNKVAKIGEGDKSSIKGKGECYCGKDFEEKDVKKLVKLLKGSEIIWEGAYLGKKHIDCNISDKTFVTLTKSLNSAFKKYSIYSCIQKIHFLAQVCEETGTFALSEETEGQHDSSKSIYKGRGILQLTGVKKKGEKLYNGEGPYKDYADYIGDPDIVKKPEVVANNVNYCIDSGAWIWSVNKRMPSDRNSEAVKRWARETAGKSLNELAVFGDKYLELISVLLNGRNKDKGNMPNGWENRKSMYTKLKTVFFQYHLYHKDDSKPVLPQGIITYNIYSDGRIERNTPKQIESGFEKKYKYVYHDKKNKEHEICIVDFVTAQNWVVGSKEDGGKGWEKRTAGGKTRYYQKGNGQVELVKVNLPIYHSEGDVLIDVGDNTDREYLNPRAFASMLGALAECGYSDFNFNGSTSLDGTGAPSVTHVNGVSFDFRYLRKDKTGNNLYINTDPNSLDVERQEKFIDALIKFGYSQFYSFNIKIKNQNFILKNSTHLADHHHHLHIRREGYKPNFKETKE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9901 - -



  Protein sequence: 911 a.a.    .

>EFF01312 NC_009441:c3915042-3912310 [Flavobacterium johnsoniae UW101]
MSDFKIIGNPDPVVGKEEFYSVNTFLPSILPFQNSASSNSFEQPVKWEIYILENGRWRKTKENDKTGKRISYTFLQKSLE
RKGIRILARRGEDVARLNVTTHPAEKPKIESIELLDKNGQKPGKPLSYGQTLKARVHCLHMEKHKVSVTLWEDDAIGAGH
NKANENNLIQTLSGVVANGKADVDFLLRPSFAKIAKQNGPEEGKIHEYYVTVDFNKDKIASNNVNVNDLEAPVAPFKGKV
PVQQQAPAKPKASLPQPTQPKTKAPATGSSSAPKVKAEITRVHITNSAKQPIKGTHKEKEIIVWVDSQGLIGKEIRFKLY
DEDYLSNDLLVDQKFKITGDIFPITVQLDRILRSKGGISGEGAEQELFADVEVIQTSIHSKSEVVDVDAKVFKPDPVDST
NKVAKIGEGDKSSIKGKGECYCGKDFEEKDVKKLVKLLKGSEIIWEGAYLGKKHIDCNISDKTFVTLTKSLNSAFKKYSI
YSCIQKIHFLAQVCEETGTFALSEETEGQHDSSKSIYKGRGILQLTGVKKKGEKLYNGEGPYKDYADYIGDPDIVKKPEV
VANNVNYCIDSGAWIWSVNKRMPSDRNSEAVKRWARETAGKSLNELAVFGDKYLELISVLLNGRNKDKGNMPNGWENRKS
MYTKLKTVFFQYHLYHKDDSKPVLPQGIITYNIYSDGRIERNTPKQIESGFEKKYKYVYHDKKNKEHEICIVDFVTAQNW
VVGSKEDGGKGWEKRTAGGKTRYYQKGNGQVELVKVNLPIYHSEGDVLIDVGDNTDREYLNPRAFASMLGALAECGYSDF
NFNGSTSLDGTGAPSVTHVNGVSFDFRYLRKDKTGNNLYINTDPNSLDVERQEKFIDALIKFGYSQFYSFNIKIKNQNFI
LKNSTHLADHHHHLHIRREGYKPNFKETKE*

  Nucleotide sequence: 2733 bp    .

>EFF01312 NC_009441:c3915042-3912310 [Flavobacterium johnsoniae UW101]
ATGTCAGATTTTAAAATAATTGGAAATCCGGATCCTGTTGTAGGTAAGGAAGAATTCTACTCAGTAAATACTTTTTTACC
GAGTATTCTGCCTTTTCAAAATTCAGCTTCTAGTAATAGTTTTGAACAGCCAGTAAAATGGGAAATATATATTCTCGAAA
ATGGAAGATGGCGCAAGACTAAAGAAAATGATAAAACAGGAAAAAGAATCTCTTACACCTTTCTTCAAAAAAGTTTAGAA
AGAAAAGGAATCCGCATTCTGGCAAGAAGAGGAGAAGATGTGGCACGTCTGAATGTAACGACACATCCCGCCGAAAAACC
AAAAATTGAAAGCATAGAACTGCTTGATAAAAACGGACAAAAACCAGGAAAACCACTTTCATACGGACAGACTTTAAAAG
CAAGGGTTCACTGTCTTCATATGGAAAAACACAAAGTATCTGTTACCTTATGGGAAGATGATGCTATTGGTGCCGGACAT
AACAAAGCAAATGAAAATAATCTAATACAAACTCTTTCAGGAGTTGTTGCAAACGGTAAAGCAGATGTTGACTTTTTGCT
GAGACCAAGTTTTGCTAAAATTGCAAAACAAAATGGGCCGGAAGAAGGTAAAATTCACGAATACTATGTTACTGTTGATT
TTAACAAAGATAAAATTGCAAGTAACAACGTAAACGTAAATGATCTTGAAGCTCCTGTAGCGCCTTTTAAAGGTAAAGTT
CCGGTACAGCAGCAAGCACCTGCTAAACCCAAAGCTTCTCTACCACAGCCGACACAGCCAAAAACTAAAGCACCAGCCAC
GGGATCTTCATCAGCGCCAAAAGTTAAAGCAGAAATTACCAGAGTACATATTACAAACTCTGCTAAACAGCCTATAAAAG
GAACTCACAAGGAAAAAGAAATTATCGTTTGGGTTGACTCACAAGGTTTGATTGGAAAAGAGATCCGTTTTAAATTATAT
GATGAAGATTATTTAAGTAATGATTTATTAGTTGATCAAAAATTTAAGATTACTGGCGATATATTTCCAATTACTGTACA
ACTAGACAGGATATTAAGAAGCAAAGGAGGGATTTCTGGAGAAGGTGCAGAGCAGGAATTGTTTGCTGATGTTGAAGTTA
TACAAACTAGTATACATAGCAAAAGTGAAGTAGTTGATGTAGATGCTAAAGTTTTTAAACCAGATCCTGTTGATTCAACT
AATAAGGTTGCGAAGATTGGAGAAGGGGATAAGAGCAGTATTAAAGGTAAAGGAGAGTGTTATTGCGGTAAAGATTTTGA
AGAAAAAGATGTTAAAAAGTTAGTAAAACTTTTAAAAGGATCAGAAATTATCTGGGAAGGAGCTTATTTAGGAAAAAAAC
ATATAGATTGTAATATTAGCGATAAAACGTTTGTTACTCTGACAAAGTCATTAAATAGTGCTTTTAAAAAATATAGCATA
TACTCCTGTATTCAGAAAATACATTTTCTTGCTCAAGTTTGTGAAGAAACAGGAACTTTTGCTTTGTCTGAAGAAACAGA
AGGTCAGCATGACTCTAGTAAAAGCATATACAAAGGTCGAGGAATATTACAACTTACAGGAGTTAAAAAAAAGGGAGAAA
AATTATATAATGGAGAAGGACCTTATAAGGATTATGCTGATTATATAGGAGATCCAGATATTGTTAAGAAACCAGAAGTT
GTAGCTAATAATGTGAATTATTGTATTGATAGTGGTGCATGGATATGGAGTGTAAATAAGAGAATGCCCTCAGATAGAAA
TTCAGAAGCAGTGAAAAGATGGGCAAGAGAAACAGCAGGAAAATCACTCAATGAGTTAGCGGTTTTTGGTGATAAATATT
TAGAATTGATTTCTGTTTTACTTAATGGAAGAAATAAAGATAAAGGAAATATGCCTAATGGATGGGAAAATAGAAAGAGT
ATGTATACTAAACTAAAAACAGTCTTCTTTCAATATCATCTTTATCATAAAGATGACTCTAAACCAGTATTGCCACAGGG
TATTATTACATATAACATATATTCTGACGGAAGGATAGAAAGAAATACTCCAAAACAAATCGAGTCTGGTTTTGAAAAGA
AATATAAGTATGTTTATCATGATAAAAAGAATAAAGAACATGAAATATGTATTGTTGATTTTGTAACTGCTCAAAATTGG
GTTGTTGGTTCAAAAGAAGATGGAGGTAAAGGCTGGGAGAAAAGAACTGCAGGAGGAAAAACGCGTTACTATCAAAAAGG
TAATGGACAGGTTGAGCTAGTAAAAGTAAACCTGCCAATATATCATAGTGAAGGTGATGTATTAATTGATGTTGGTGATA
ACACAGATAGGGAATATTTAAATCCACGTGCTTTTGCATCCATGCTGGGAGCTTTAGCTGAATGTGGTTATTCGGATTTT
AATTTTAATGGCTCTACTTCCCTAGATGGAACAGGAGCACCAAGTGTAACCCATGTAAATGGAGTCTCTTTTGACTTTAG
ATATTTAAGAAAAGATAAGACGGGTAATAACCTATATATTAATACAGATCCTAATTCTTTGGATGTAGAGAGACAAGAAA
AATTTATCGATGCTCTTATAAAATTTGGTTACTCTCAGTTCTATAGTTTTAACATTAAAATTAAAAATCAAAATTTTATA
CTTAAAAATTCAACTCATTTAGCTGATCATCACCACCATTTGCACATTCGAAGAGAGGGATATAAACCAAATTTTAAAGA
AACAAAAGAATAG