Detailed information of effector


Summary

Effector ID EFF01309 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00904 experimental (Type i2)
Strain Escherichia coli strain TW-XM
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description Hcp1 was assembled in the T6SS complexes and secreted into the extracellular matrix to activate humoral immunity during duck infection.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) xmoF (Hcp1)
Coordinates (Strand) 5838..6329 (+)
NCBI ID 611963684
GenBank KF678349
Uniprot ID X5FUJ5_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.5e-38 6..146

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSPYLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYEKITWTYKDGNIIHSDSWNERPSA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9853 - -



  Protein sequence: 164 a.a.    .

>EFF01309 KF678349:5838-6329 [Escherichia coli]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSPYLYKAVTTGQ
TLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYEKITWTYKDGNIIHSDSWNER
PSA*

  Nucleotide sequence: 492 bp    .

>EFF01309 KF678349:5838-6329 [Escherichia coli]
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTCAGGGGCGCGA
AGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACACCGGCAAACTGACCGGTACCC
GTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCGTATCTCTACAAAGCTGTGACCACCGGACAG
ACCCTGAAAACGGCGGAGTTTAAATTCTACCGCATCAACGATGCCGGTCAGGAAGTGGAGTATTTCAATACCACGCTGGA
TAACGTCAAGCTGGTCAGAGTAGCTCCGCTGATGCACGACATCAAAGATCCGGGTAAAGAGAAGCATAACCACCTGGAAC
GCATTGAGTTCCGCTACGAGAAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGT
CCTTCCGCCTGA