Detailed information of effector


Summary

Effector ID EFF01308 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome
Sequence Protein sequence (279 a.a.); Nucleotide sequence (837 bp)
Description Tde1; DNase Effector
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Atu4350 (Tde1)
Coordinates (Strand) 1484901..1485737 (+)
NCBI ID 15890633
RefSeq NC_003063
Uniprot ID A9CGH1_AGRFC
KEGG ID atu:Atu4350
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ntox15 PF15604.8 2e-55 100..247

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-278 MSATTTVAGAGGAIAGGWLGRVIGGLAGSLAGPGGTAVGAWIGGQVGAMAGRAAASAIASYMEDANVDADAKTKESEQAKPCVDCGEIDCFSPPEGATPKQVEEFRRQLKEQQDEINRMEPDDLVRNIDKYRQQGRPTDDAANRRQSREDYRTDRTRELEEKYLSKGRNDYKEQAANDVAEEMKKLAATHTLDLVAGGDGSISGLGDKSINSSLGSQWKGRRSEQLRSHAKKAAEQKKKMNAKLEECKPEGGNDNSPDAETPDNGTGKGDGNPDVPVS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.4580 - -



  Protein sequence: 279 a.a.    .

>EFF01308 NC_003063:1484901-1485737 [Agrobacterium fabrum str. C58]
MSATTTVAGAGGAIAGGWLGRVIGGLAGSLAGPGGTAVGAWIGGQVGAMAGRAAASAIASYMEDANVDADAKTKESEQAK
PCVDCGEIDCFSPPEGATPKQVEEFRRQLKEQQDEINRMEPDDLVRNIDKYRQQGRPTDDAANRRQSREDYRTDRTRELE
EKYLSKGRNDYKEQAANDVAEEMKKLAATHTLDLVAGGDGSISGLGDKSINSSLGSQWKGRRSEQLRSHAKKAAEQKKKM
NAKLEECKPEGGNDNSPDAETPDNGTGKGDGNPDVPVS*

  Nucleotide sequence: 837 bp    .

>EFF01308 NC_003063:1484901-1485737 [Agrobacterium fabrum str. C58]
ATGAGTGCGACGACAACTGTCGCCGGAGCGGGCGGTGCTATCGCAGGAGGTTGGCTCGGTCGTGTTATTGGAGGCTTAGC
TGGCAGCCTCGCTGGGCCTGGAGGTACAGCGGTTGGAGCATGGATAGGTGGGCAAGTCGGCGCTATGGCGGGTAGAGCGG
CTGCCTCCGCAATCGCCTCTTATATGGAAGATGCGAATGTAGACGCTGACGCCAAGACCAAGGAGAGCGAACAGGCCAAA
CCTTGCGTTGATTGTGGGGAAATCGATTGCTTTAGTCCGCCTGAGGGAGCTACGCCTAAGCAAGTTGAAGAGTTTAGGCG
TCAGTTGAAGGAGCAACAAGACGAAATAAACCGCATGGAGCCTGATGATCTGGTCAGAAATATCGACAAATATAGACAGC
AGGGGAGGCCGACTGATGATGCAGCAAACCGTCGGCAGAGTAGAGAAGATTATCGCACCGACCGCACACGGGAACTGGAA
GAAAAGTATTTATCGAAAGGGCGCAATGACTATAAGGAACAGGCTGCGAATGATGTGGCAGAAGAGATGAAGAAGTTGGC
CGCAACCCATACCTTGGATTTGGTTGCGGGGGGCGACGGATCAATTTCTGGCTTGGGCGACAAGAGTATCAATAGTTCTT
TAGGGTCTCAATGGAAGGGAAGAAGATCGGAGCAATTGCGCTCTCATGCAAAAAAAGCGGCTGAGCAAAAGAAAAAAATG
AACGCTAAACTCGAAGAATGTAAACCCGAAGGCGGCAATGATAATTCTCCCGATGCTGAAACTCCCGACAATGGTACAGG
TAAGGGGGACGGCAATCCTGACGTCCCGGTGTCTTGA