Detailed information of effector


Summary

Effector ID EFF01295 experimental
Effector type Tde
Cognate immunity protein -
Related T6SS (Type) T6SS00043 experimental (Type i1)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome
Sequence Protein sequence (859 a.a.); Nucleotide sequence (2577 bp)
Description T6SS1 effector from V. parahaemolyticus RIMD 2210633 with a pre- dicted colicin DNase domain.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VP_RS21220
Coordinates (Strand) 1341875..1344451 (+)
NCBI ID 28901118
RefSeq NC_004605
Uniprot ID Q87GQ2_VIBPA
KEGG ID vpa:VPA1263
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Pyocin_S PF06958.14 5.4e-30 590..723

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-858 MSHEFGLIEGNFHNISEADIASAIPSHLTFEQLKQHLYEGNLALVSDTPQTPALLSYNDPIGPKTWRLNSEVISELSDDAANNLLAITKTTRATGGYRSCIGETSTLERVYTPQPIATESEEEITKEFEYSFEVGCSDATIKKMVHSDFALAKTEKENAVTRWEQTNTEQGTRYTALCVFDEPKRLNIHIADDNLGLTPLEAVTLQKAGSCKTDEGFIPVVPAVRLGERLGLPTEGYYYHFNDGELVQEYKILGEEKWAFYATQSTQDKLNDERGFTKDQSAILVYWKLADQIIENQYIIYLERQITREELDNLSEDWLCENGIKLDIPALFDAVKQPEEARSEGNNDETQAEQTAATHTVTVGEDWQSIAELYGMGAKALLLLNPVFEADPLSLAVGDEIIVAEKQQQQAPDKKNTFPPLRPQTYNNIRNSHYQHSDPLLGLTKYRAINTADCIEGDVVILNLKDATSSIVFAKSCTRPEGCIEIGDQQESISNFGPWSFFFAQANANPAAVIPAIQATQAQMAMGSSAAVAGSPEQMQQTQTAAMQLDKLAGTLKEKIVEGYRWQVEGIGALFAMQQSLFGDNTQYTDQDLRQVTTAQSRVRVHITEPQGGEFYPHVQGYHVDDTRIPIKYVKQGNNGQLSVAIEENGPTIYWTPEENGEASWQTTPDHSDGFEKDDILVTPIHSDSDANVTVTPAPEEKDWRDAILVFPESSGIAPLYVVYKESPRDKPGVVTGKGEDIFGIWLADAGKDLGAPIPSQIADKLRGREFSSFDAFREGFWYAVGEDQTLINQFSRANQRLIKRGRSPFSLPSEQVGGRQRYELHHKEEIQYGGEVFHVDNLCVLTPKRHISIHKDQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9903 - -



  Protein sequence: 859 a.a.    .

>EFF01295 NC_004605:1341875-1344451 [Vibrio parahaemolyticus RIMD 2210633]
MSHEFGLIEGNFHNISEADIASAIPSHLTFEQLKQHLYEGNLALVSDTPQTPALLSYNDPIGPKTWRLNSEVISELSDDA
ANNLLAITKTTRATGGYRSCIGETSTLERVYTPQPIATESEEEITKEFEYSFEVGCSDATIKKMVHSDFALAKTEKENAV
TRWEQTNTEQGTRYTALCVFDEPKRLNIHIADDNLGLTPLEAVTLQKAGSCKTDEGFIPVVPAVRLGERLGLPTEGYYYH
FNDGELVQEYKILGEEKWAFYATQSTQDKLNDERGFTKDQSAILVYWKLADQIIENQYIIYLERQITREELDNLSEDWLC
ENGIKLDIPALFDAVKQPEEARSEGNNDETQAEQTAATHTVTVGEDWQSIAELYGMGAKALLLLNPVFEADPLSLAVGDE
IIVAEKQQQQAPDKKNTFPPLRPQTYNNIRNSHYQHSDPLLGLTKYRAINTADCIEGDVVILNLKDATSSIVFAKSCTRP
EGCIEIGDQQESISNFGPWSFFFAQANANPAAVIPAIQATQAQMAMGSSAAVAGSPEQMQQTQTAAMQLDKLAGTLKEKI
VEGYRWQVEGIGALFAMQQSLFGDNTQYTDQDLRQVTTAQSRVRVHITEPQGGEFYPHVQGYHVDDTRIPIKYVKQGNNG
QLSVAIEENGPTIYWTPEENGEASWQTTPDHSDGFEKDDILVTPIHSDSDANVTVTPAPEEKDWRDAILVFPESSGIAPL
YVVYKESPRDKPGVVTGKGEDIFGIWLADAGKDLGAPIPSQIADKLRGREFSSFDAFREGFWYAVGEDQTLINQFSRANQ
RLIKRGRSPFSLPSEQVGGRQRYELHHKEEIQYGGEVFHVDNLCVLTPKRHISIHKDQ*

  Nucleotide sequence: 2577 bp    .

>EFF01295 NC_004605:1341875-1344451 [Vibrio parahaemolyticus RIMD 2210633]
ATGTCTCATGAATTTGGATTGATAGAGGGCAACTTCCATAATATTTCGGAAGCGGATATCGCCTCTGCTATTCCTTCACA
TCTTACTTTTGAACAACTAAAGCAGCATCTCTACGAAGGTAATCTCGCACTCGTTAGTGATACGCCTCAAACTCCTGCTC
TGCTTAGTTACAACGACCCAATAGGTCCTAAAACTTGGCGGCTGAATTCTGAGGTTATCTCTGAACTTTCGGATGATGCG
GCTAATAATTTGTTAGCAATAACGAAAACCACCAGAGCAACGGGAGGTTACCGCTCTTGTATCGGGGAAACCTCGACGCT
CGAACGAGTTTACACGCCGCAGCCAATCGCAACCGAAAGTGAAGAGGAAATCACCAAGGAATTTGAGTACAGCTTTGAAG
TTGGCTGCTCGGATGCCACCATAAAGAAAATGGTGCACAGTGACTTTGCTTTAGCGAAAACTGAAAAAGAGAACGCGGTA
ACCCGCTGGGAACAAACCAATACCGAGCAAGGCACCCGCTACACTGCGTTATGTGTATTTGATGAGCCAAAGCGTTTAAA
TATCCACATAGCTGATGACAATCTCGGGCTGACGCCACTGGAAGCCGTCACATTACAAAAAGCCGGCAGCTGTAAAACGG
ACGAAGGTTTTATACCTGTTGTCCCTGCAGTGCGATTGGGCGAACGTTTAGGTTTGCCTACAGAAGGTTATTACTACCAC
TTTAATGATGGCGAACTTGTCCAAGAATACAAAATTCTAGGAGAAGAAAAGTGGGCGTTTTACGCAACGCAATCGACACA
AGACAAGCTCAATGATGAGCGTGGTTTTACCAAAGACCAAAGCGCAATTTTGGTGTATTGGAAATTAGCTGATCAAATCA
TCGAGAATCAATACATCATTTATCTTGAGCGCCAAATCACCCGAGAAGAGCTTGATAATCTAAGTGAAGATTGGCTGTGT
GAAAACGGGATAAAGTTGGATATCCCCGCATTGTTTGATGCGGTCAAACAGCCGGAAGAAGCGCGCTCAGAAGGTAACAA
CGATGAGACGCAAGCGGAACAAACCGCAGCGACGCACACCGTAACGGTAGGGGAAGACTGGCAAAGCATCGCTGAACTAT
ATGGTATGGGAGCTAAAGCCTTGCTCTTGCTTAACCCAGTGTTTGAGGCCGACCCTCTGTCACTTGCGGTAGGTGATGAA
ATTATTGTTGCTGAGAAACAGCAACAACAAGCACCGGACAAAAAGAATACCTTTCCGCCGCTGCGCCCACAAACTTACAA
CAACATCCGCAACAGTCATTATCAGCACAGTGATCCATTGCTCGGGTTGACCAAATATAGAGCCATTAACACTGCCGATT
GCATAGAAGGCGATGTGGTAATCCTCAATTTAAAAGACGCCACAAGCTCGATCGTGTTCGCTAAATCCTGCACCAGACCA
GAGGGATGTATTGAAATTGGCGACCAACAAGAGTCAATAAGTAACTTTGGTCCTTGGTCATTCTTCTTTGCACAAGCCAA
TGCAAACCCAGCTGCTGTCATACCCGCCATTCAAGCGACACAAGCACAAATGGCTATGGGCAGTTCCGCAGCTGTCGCCG
GTTCCCCAGAGCAAATGCAGCAAACCCAAACCGCAGCGATGCAGTTAGATAAACTGGCCGGCACATTGAAAGAAAAAATC
GTCGAGGGCTACCGCTGGCAGGTCGAAGGTATTGGCGCTTTGTTTGCCATGCAGCAAAGCTTATTTGGCGATAACACCCA
ATACACAGACCAAGATTTACGCCAAGTAACCACGGCGCAAAGCCGCGTTCGTGTCCACATTACCGAGCCCCAAGGTGGTG
AGTTTTATCCGCACGTACAGGGCTATCATGTAGATGACACACGAATCCCCATCAAATATGTGAAACAAGGGAACAATGGT
CAGTTGTCCGTTGCGATTGAAGAGAACGGACCAACCATCTATTGGACACCAGAAGAAAACGGTGAAGCAAGTTGGCAAAC
TACCCCCGATCATAGTGATGGGTTTGAAAAAGACGATATACTTGTCACGCCAATTCACTCGGATAGTGATGCAAACGTCA
CCGTTACGCCTGCGCCAGAAGAGAAAGACTGGCGCGATGCGATCTTGGTATTCCCTGAAAGCTCAGGTATTGCTCCGCTC
TATGTGGTTTACAAAGAAAGCCCGAGAGATAAGCCCGGAGTAGTTACTGGTAAGGGCGAAGATATCTTTGGTATCTGGTT
AGCTGATGCGGGTAAAGACTTGGGTGCTCCAATACCTTCCCAAATTGCTGATAAGCTAAGAGGAAGAGAGTTCAGTAGCT
TTGATGCATTTAGAGAAGGCTTTTGGTACGCCGTTGGTGAAGACCAAACTTTAATCAACCAGTTCAGCCGTGCGAATCAA
CGTTTGATCAAGAGAGGCCGTTCTCCTTTTTCGCTACCAAGTGAACAAGTTGGAGGGAGACAAAGGTATGAGTTACACCA
CAAAGAAGAGATACAGTATGGTGGAGAAGTATTCCATGTAGATAATTTATGTGTCCTTACCCCGAAACGACATATCAGCA
TACATAAGGATCAATAA