Detailed information of effector


Summary

Effector ID EFF01271 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (163 a.a.); Nucleotide sequence (489 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS04505
Coordinates (Strand) 1018597..1019085 (-)
NCBI ID 83716550
RefSeq NC_007650
Uniprot ID UPI0000667454
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.3e-38 6..146

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-162 MPMPCYLTLEGQTQGSIEGSCDIQGHEGKILVQAVEHTIEIPKSPQTGLPTSKRLHGPMTLTKEIDKSSPKLSQALASGEQMKSVVLEFYRILKEGKEEHYYTVKLENAILTSIRSWTPNCLVLDNKQLGHMEDVSFTYEKITWTYVPDGIEAEDSWRAPKV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9624 - -



  Protein sequence: 163 a.a.    .

>EFF01271 NC_007650:c1019085-1018597 [Burkholderia thailandensis E264]
MPMPCYLTLEGQTQGSIEGSCDIQGHEGKILVQAVEHTIEIPKSPQTGLPTSKRLHGPMTLTKEIDKSSPKLSQALASGE
QMKSVVLEFYRILKEGKEEHYYTVKLENAILTSIRSWTPNCLVLDNKQLGHMEDVSFTYEKITWTYVPDGIEAEDSWRAP
KV*

  Nucleotide sequence: 489 bp    .

>EFF01271 NC_007650:c1019085-1018597 [Burkholderia thailandensis E264]
ATGCCGATGCCGTGCTATCTCACGCTCGAAGGGCAAACCCAGGGCAGCATCGAGGGTTCCTGCGACATCCAGGGCCACGA
GGGCAAGATTCTCGTCCAGGCCGTCGAGCACACGATCGAGATCCCGAAGAGCCCGCAAACGGGCCTGCCGACCAGCAAGC
GGCTCCACGGGCCGATGACGCTGACCAAGGAGATCGACAAGTCGTCGCCGAAGCTGTCTCAGGCGCTCGCGTCCGGCGAG
CAGATGAAGTCGGTCGTGCTCGAGTTCTACCGGATTCTGAAGGAAGGCAAGGAAGAGCACTACTACACGGTCAAGCTCGA
GAACGCGATCCTCACGAGCATCCGCTCCTGGACGCCGAACTGCCTCGTGCTCGACAACAAGCAGCTCGGCCACATGGAAG
ACGTATCGTTCACGTACGAGAAGATCACGTGGACCTACGTGCCGGACGGCATCGAGGCCGAGGACTCATGGCGCGCGCCG
AAGGTGTGA