Detailed information of effector


Summary

Effector ID EFF01125 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (1035 a.a.); Nucleotide sequence (3105 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BB2000_RS14610
Coordinates (Strand) 3279668..3282772 (+)
NCBI ID 529238655
RefSeq NC_022000
Uniprot ID UPI00017A2F79
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-692 MTGEVNEKYLTPQERKARQMVKAVNEASPRNLPADAVVCPCENEHRPVYPVRYAYTNFYCDLHFSTIEQAPNKTLEASIPPSINQLLNAKDVTASKGFSARLLRQGWVYVFEEGNYPTRSNSSNKSYQEQNVDATKGRLLVFQHQVTTSDGNENFIPYIFKQLKNGGVTLKKNGNSNPYLAIPKDVKEATILFSESKLSDYTLKKIISSSKFRSKLMQKINFIDYNNNDYCIELNKDNLNRLVEDYKEEVDKFKLFVKEFTHSNIPSSFFSDTTKIPDLPQDATVLINQVNSVLDYNEKATLLILKDPVGYQKDILSYYNIVTKLHLLYQNYYSHPDKIGQFITSIQEASHHIKDTDEKEKMQTILKESINQNALDNEWKNIHKTFIFFEKHQRIVLSLYESFMNNPAIINENGGLKHYFDYAFSYHERITKEDVFSIDFFKDLNQAFDLYFDLVSPLMNSIEGQRTLDKLYSINDEENNSLWVGVTKKVISLIANSKIKDALLNVQEYAMHIENFVNKLAFICSDSIGFAFTKTSKVLSHYDIKNRLINTKGIDYLAQKILPMILAFCNTKISLTEFVKLSGNELNQWMEQLRKLTGQIVPNLQHPKLNKLFSWKQKIINLGEETAVLIPKIEIIDITKNKIYIYGKDALQVSTKLFLNGFSMITGSIQAYTLQGMSLYERNDPLKLSPYN
Transmembrane helix 693-710 LYTAQIIANLFVASYSIL
Inside 711-782 KVSQEATKLSQTVSSTTLKFFLDKIKLPMLTTEVGTKRMAALGKIAGAVGAALAARDALEAFHIGNYKQSVS
Transmembrane helix 783-805 NIAIVIGSIILITAVTGGWALFA
Outside 806-1034 GALILGGFISSQLTSWSHLETLLKHSFWGNEKRSNFWDNDRPTPIGEQLKQYIKEFEFYKQKGLIELQEFYNLFYTAKMTQEKIPNGKLRLSFEFTNFTPGISEVYFHFVTEVGYHSGLAEEIKTPSSAYVLNKRKDLLEISEQLKMASEKGDWNPETGIFKFSLEVQSQLVNTYSAFGAHPNSRIGIEDLYWYYQVNPEVTTPMRYINWGGDTQENNQLLGFINSENI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9583 - -



  Protein sequence: 1035 a.a.    .

>EFF01125 NC_022000:3279668-3282772 [Proteus mirabilis BB2000]
MTGEVNEKYLTPQERKARQMVKAVNEASPRNLPADAVVCPCENEHRPVYPVRYAYTNFYCDLHFSTIEQAPNKTLEASIP
PSINQLLNAKDVTASKGFSARLLRQGWVYVFEEGNYPTRSNSSNKSYQEQNVDATKGRLLVFQHQVTTSDGNENFIPYIF
KQLKNGGVTLKKNGNSNPYLAIPKDVKEATILFSESKLSDYTLKKIISSSKFRSKLMQKINFIDYNNNDYCIELNKDNLN
RLVEDYKEEVDKFKLFVKEFTHSNIPSSFFSDTTKIPDLPQDATVLINQVNSVLDYNEKATLLILKDPVGYQKDILSYYN
IVTKLHLLYQNYYSHPDKIGQFITSIQEASHHIKDTDEKEKMQTILKESINQNALDNEWKNIHKTFIFFEKHQRIVLSLY
ESFMNNPAIINENGGLKHYFDYAFSYHERITKEDVFSIDFFKDLNQAFDLYFDLVSPLMNSIEGQRTLDKLYSINDEENN
SLWVGVTKKVISLIANSKIKDALLNVQEYAMHIENFVNKLAFICSDSIGFAFTKTSKVLSHYDIKNRLINTKGIDYLAQK
ILPMILAFCNTKISLTEFVKLSGNELNQWMEQLRKLTGQIVPNLQHPKLNKLFSWKQKIINLGEETAVLIPKIEIIDITK
NKIYIYGKDALQVSTKLFLNGFSMITGSIQAYTLQGMSLYERNDPLKLSPYNLYTAQIIANLFVASYSILKVSQEATKLS
QTVSSTTLKFFLDKIKLPMLTTEVGTKRMAALGKIAGAVGAALAARDALEAFHIGNYKQSVSNIAIVIGSIILITAVTGG
WALFAGALILGGFISSQLTSWSHLETLLKHSFWGNEKRSNFWDNDRPTPIGEQLKQYIKEFEFYKQKGLIELQEFYNLFY
TAKMTQEKIPNGKLRLSFEFTNFTPGISEVYFHFVTEVGYHSGLAEEIKTPSSAYVLNKRKDLLEISEQLKMASEKGDWN
PETGIFKFSLEVQSQLVNTYSAFGAHPNSRIGIEDLYWYYQVNPEVTTPMRYINWGGDTQENNQLLGFINSENI*

  Nucleotide sequence: 3105 bp    .

>EFF01125 NC_022000:3279668-3282772 [Proteus mirabilis BB2000]
ATGACTGGAGAAGTGAATGAGAAATATTTAACACCGCAAGAGCGCAAAGCGCGTCAGATGGTGAAGGCGGTAAACGAAGC
GAGCCCACGAAACTTACCGGCCGACGCGGTGGTATGCCCATGTGAAAATGAACATCGCCCTGTTTATCCGGTGCGTTATG
CATATACCAACTTTTATTGTGATTTACATTTTTCTACAATTGAACAAGCACCAAATAAAACGTTAGAAGCGAGTATTCCT
CCTTCTATTAATCAATTATTGAATGCGAAAGATGTTACTGCTAGTAAAGGATTTTCTGCAAGATTATTAAGACAAGGTTG
GGTTTATGTTTTTGAAGAAGGCAATTACCCTACTAGAAGTAATTCTAGCAATAAAAGTTATCAAGAACAAAATGTTGATG
CAACAAAAGGACGCCTATTAGTTTTTCAACATCAAGTGACAACCAGTGATGGCAATGAAAATTTCATTCCATATATATTT
AAGCAATTAAAAAATGGGGGTGTCACTTTAAAGAAAAACGGAAATAGTAATCCTTATTTAGCTATACCGAAAGATGTGAA
GGAAGCGACTATCTTATTCAGCGAAAGTAAATTATCTGATTACACACTTAAAAAAATCATTTCATCTTCTAAGTTTAGAT
CGAAATTAATGCAAAAAATCAATTTTATTGATTACAATAATAACGATTATTGTATTGAGCTAAATAAAGATAATTTAAAT
CGACTTGTTGAGGATTATAAAGAAGAAGTTGATAAATTTAAGCTATTTGTTAAAGAATTCACGCATTCAAATATACCCTC
TTCTTTTTTTTCTGATACCACAAAAATACCCGACTTACCACAAGATGCAACTGTTTTGATTAATCAAGTAAATAGTGTTC
TAGATTATAATGAAAAAGCGACATTGCTTATTTTAAAAGATCCCGTAGGATACCAAAAAGATATTTTATCTTATTATAAT
ATTGTAACAAAATTACATTTATTATATCAGAACTATTATAGCCATCCGGATAAAATTGGCCAATTTATTACGAGTATACA
AGAAGCTAGTCATCACATTAAAGATACTGATGAAAAAGAAAAAATGCAAACAATACTAAAAGAGAGTATTAATCAGAATG
CATTAGATAATGAGTGGAAAAATATTCATAAAACATTTATTTTTTTTGAGAAACATCAACGTATTGTATTATCATTGTAT
GAAAGCTTTATGAATAATCCGGCAATCATTAATGAAAACGGTGGCTTAAAACATTATTTTGATTATGCTTTTTCATATCA
CGAACGTATAACTAAAGAAGATGTCTTTAGTATTGATTTTTTTAAGGACCTTAATCAAGCTTTTGATTTATATTTTGATT
TAGTATCTCCATTAATGAATTCTATCGAAGGACAAAGAACATTAGATAAATTATATTCAATTAATGATGAAGAAAATAAT
AGCCTGTGGGTGGGAGTGACAAAGAAAGTAATTAGTCTTATTGCTAATTCAAAAATTAAGGACGCTCTTTTAAATGTACA
AGAATATGCAATGCATATCGAAAATTTTGTTAATAAGCTTGCATTTATTTGCTCAGATAGCATTGGTTTCGCGTTTACAA
AAACAAGTAAGGTACTTTCTCATTACGATATTAAAAATAGACTAATTAATACTAAGGGTATTGACTATTTAGCCCAAAAG
ATACTTCCGATGATACTGGCATTTTGCAACACAAAAATTTCATTAACCGAGTTTGTTAAATTATCGGGTAATGAGCTTAA
CCAGTGGATGGAACAACTCCGTAAATTAACGGGACAAATAGTACCAAATCTGCAACATCCTAAATTAAATAAGCTTTTTT
CTTGGAAACAAAAAATAATAAATCTAGGCGAAGAGACTGCCGTTCTTATTCCGAAGATTGAGATCATAGATATTACTAAA
AATAAGATTTATATTTATGGCAAAGATGCATTACAGGTTTCCACTAAGCTATTTTTAAACGGTTTCAGCATGATCACCGG
ATCAATCCAAGCTTATACATTACAAGGTATGAGTTTGTATGAACGTAATGACCCATTAAAACTATCCCCCTATAATCTGT
ATACAGCACAGATTATTGCGAATTTATTTGTAGCAAGCTACAGTATTTTAAAAGTTTCTCAAGAGGCGACAAAATTATCT
CAAACAGTATCGAGCACCACACTGAAATTCTTTTTAGATAAAATAAAATTACCTATGCTAACAACAGAAGTGGGAACCAA
AAGAATGGCAGCATTAGGTAAGATTGCAGGTGCCGTTGGTGCCGCTCTTGCCGCTCGTGACGCATTAGAAGCTTTTCATA
TTGGAAATTATAAACAATCTGTATCAAATATAGCTATTGTGATTGGTTCTATAATTTTAATTACTGCTGTTACTGGAGGA
TGGGCTTTATTTGCTGGGGCACTTATTTTGGGGGGATTTATCTCAAGCCAACTCACCAGTTGGAGTCATTTAGAAACTTT
ACTAAAACATAGTTTTTGGGGGAATGAAAAAAGGTCTAATTTTTGGGATAATGATAGACCAACACCGATAGGAGAACAAT
TAAAACAATATATAAAAGAATTTGAATTCTATAAACAAAAAGGGCTAATTGAATTACAAGAGTTTTATAATCTATTTTAT
ACAGCTAAAATGACTCAAGAAAAAATACCAAATGGAAAACTCCGCTTATCTTTTGAATTTACTAATTTTACCCCAGGGAT
TTCAGAAGTATATTTTCACTTTGTTACAGAGGTTGGTTATCACAGCGGCTTGGCAGAAGAAATAAAAACACCTAGTTCAG
CTTATGTTCTAAATAAACGAAAAGACCTCTTAGAAATTAGCGAACAATTAAAAATGGCAAGTGAAAAAGGTGATTGGAAC
CCTGAAACAGGTATATTTAAATTTAGTTTGGAAGTACAGTCTCAATTAGTAAATACATATTCTGCTTTTGGTGCACATCC
TAATAGCCGTATAGGTATTGAAGATTTATATTGGTATTATCAAGTCAATCCCGAGGTAACAACACCGATGCGTTATATCA
ATTGGGGGGGAGATACCCAAGAAAACAATCAGCTTTTAGGCTTTATTAACAGTGAGAATATCTAA