Detailed information of effector


Summary

Effector ID EFF01124 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (724 a.a.); Nucleotide sequence (2172 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BB2000_RS14600
Coordinates (Strand) 3276277..3278448 (+)
NCBI ID 529238653
RefSeq NC_022000
Uniprot ID UPI00017A2F77
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 7.2e-64 82..374
Phage_base_V PF04717.14 1.8e-09 432..496

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-723 MSITNSKKYQRLGDKDGNSLSGDKTLTHGGGRTYAQDLALQEQHRQLIEKILSGDMQSGLVFTCQIGGLPEETFQVTQFDLQEGISQLFTLSIQAVSPLSEIDFNDVLGMASSLTVKRDGHILRTVQGILAAAEQGNTDGVKTWYQFVIRPEMWVMTLKQDSRIFQDTTVPHILETLLNESHIKYDKQLYHPEEHLQRAYTTQKRETMYDFWCRLAAEEGINFWFEEGPQLFYSDRHLGMRAGISLTYNPQSDTDITDSTATTWRYVEQLCSDIRVDKDYNQLRPSYPLSHQVTGEVHQQHEIFESYGRFEEDAQGQPFNQIRYEQSQNQRQVGSATTNCIELAPGRIFTLSNHPSARMNTTWQVISISHHGVQPLADNSGGEGTQLSNQLSFVPSTQEWRPPYRFKPTADGDELATVVGPPGEEIYTNEQGAVTVYFHWDRRGKPDHSASCWVRVAQGWNGDGFGFMAIPRVGQEVIISYLNNDIDKPIITGCTYNGRNRSPIDLPKHKTRTTFRTKTHKGDGFNELRFEDKNGDEEIYLHAQRDNNIHINHNKTQYVGHDDSHTVANNRKHEVCHDEFIHIVNEQTVQVDVNQFEQIGKDRITRIDNSWKEVIHASHFQEIGENKQCDIQNDYTLKAAGGIHTHTKIHTLQASETVIIKGKAGSIQLDAQGVTITGKILLKGDVSITGGAPEVVTQLEAAVNEGLPLAEDCRAKAMKKGTA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9802 - -



  Protein sequence: 724 a.a.    .

>EFF01124 NC_022000:3276277-3278448 [Proteus mirabilis BB2000]
MSITNSKKYQRLGDKDGNSLSGDKTLTHGGGRTYAQDLALQEQHRQLIEKILSGDMQSGLVFTCQIGGLPEETFQVTQFD
LQEGISQLFTLSIQAVSPLSEIDFNDVLGMASSLTVKRDGHILRTVQGILAAAEQGNTDGVKTWYQFVIRPEMWVMTLKQ
DSRIFQDTTVPHILETLLNESHIKYDKQLYHPEEHLQRAYTTQKRETMYDFWCRLAAEEGINFWFEEGPQLFYSDRHLGM
RAGISLTYNPQSDTDITDSTATTWRYVEQLCSDIRVDKDYNQLRPSYPLSHQVTGEVHQQHEIFESYGRFEEDAQGQPFN
QIRYEQSQNQRQVGSATTNCIELAPGRIFTLSNHPSARMNTTWQVISISHHGVQPLADNSGGEGTQLSNQLSFVPSTQEW
RPPYRFKPTADGDELATVVGPPGEEIYTNEQGAVTVYFHWDRRGKPDHSASCWVRVAQGWNGDGFGFMAIPRVGQEVIIS
YLNNDIDKPIITGCTYNGRNRSPIDLPKHKTRTTFRTKTHKGDGFNELRFEDKNGDEEIYLHAQRDNNIHINHNKTQYVG
HDDSHTVANNRKHEVCHDEFIHIVNEQTVQVDVNQFEQIGKDRITRIDNSWKEVIHASHFQEIGENKQCDIQNDYTLKAA
GGIHTHTKIHTLQASETVIIKGKAGSIQLDAQGVTITGKILLKGDVSITGGAPEVVTQLEAAVNEGLPLAEDCRAKAMKK
GTA*

  Nucleotide sequence: 2172 bp    .

>EFF01124 NC_022000:3276277-3278448 [Proteus mirabilis BB2000]
ATGTCTATAACAAATTCAAAAAAATATCAAAGGCTGGGTGATAAGGATGGCAACTCACTGAGTGGGGATAAGACATTAAC
CCATGGCGGTGGCAGAACATACGCGCAAGATCTCGCTTTACAAGAGCAACATAGACAACTCATAGAGAAGATCTTAAGTG
GCGACATGCAAAGTGGCTTAGTGTTTACTTGTCAGATTGGTGGATTACCCGAAGAGACTTTCCAAGTCACGCAATTCGAT
TTACAAGAAGGGATCTCACAACTTTTCACCCTCTCCATCCAAGCCGTCAGTCCACTCTCGGAAATTGATTTTAATGATGT
GTTAGGCATGGCTTCCAGTTTGACGGTAAAGCGAGATGGTCACATTCTGCGTACAGTACAAGGTATCTTAGCGGCGGCAG
AGCAAGGGAATACCGATGGGGTAAAAACCTGGTATCAATTTGTGATACGTCCTGAAATGTGGGTAATGACCCTCAAACAA
GATAGTCGTATTTTTCAAGATACCACCGTTCCTCATATTCTTGAGACATTACTCAATGAGTCTCACATTAAATATGATAA
ACAGCTTTATCACCCAGAAGAGCATTTGCAGCGCGCCTACACCACTCAAAAACGAGAAACAATGTATGACTTTTGGTGCC
GTTTAGCCGCAGAAGAAGGGATTAATTTTTGGTTTGAAGAGGGCCCACAGTTATTTTATAGCGACCGACATTTGGGCATG
AGAGCGGGGATATCCTTAACCTATAACCCACAATCGGATACAGATATCACCGATAGCACCGCCACAACGTGGCGCTATGT
TGAACAACTCTGTAGCGATATTCGCGTTGATAAAGATTACAATCAACTTAGACCTTCCTACCCCTTAAGCCATCAAGTCA
CAGGAGAGGTTCATCAACAACATGAAATATTTGAAAGTTATGGACGCTTTGAAGAAGATGCTCAGGGACAACCCTTTAAT
CAGATACGTTATGAACAATCACAAAATCAGCGTCAAGTAGGCTCTGCGACCACAAACTGCATTGAATTAGCGCCGGGGCG
TATTTTTACCTTGTCTAACCACCCCAGTGCACGCATGAACACCACATGGCAGGTGATTAGTATCTCACATCACGGTGTGC
AACCTCTTGCCGACAACAGTGGCGGTGAAGGAACGCAATTGAGTAATCAGCTTTCCTTTGTGCCGAGTACTCAAGAGTGG
CGCCCGCCTTACCGTTTTAAACCTACCGCCGATGGTGATGAATTAGCCACTGTCGTCGGCCCGCCGGGCGAAGAAATCTA
TACCAATGAGCAAGGTGCCGTTACGGTCTATTTTCATTGGGATAGGCGTGGTAAACCAGACCATAGCGCATCATGCTGGG
TAAGAGTCGCTCAAGGTTGGAATGGGGACGGGTTTGGCTTTATGGCTATTCCTCGTGTTGGGCAAGAAGTGATTATCTCT
TATTTAAACAATGATATAGATAAACCGATTATCACCGGATGTACCTATAATGGTCGCAATCGTTCCCCCATTGATTTACC
TAAACATAAAACCCGTACCACATTTCGCACCAAAACCCATAAAGGTGATGGCTTTAATGAATTGCGCTTTGAGGATAAAA
ATGGCGATGAGGAAATTTATCTTCATGCGCAACGCGATAATAATATTCATATTAATCATAATAAAACCCAATACGTTGGG
CATGATGATAGCCATACTGTCGCCAATAACCGTAAGCATGAAGTGTGTCATGACGAATTTATCCACATCGTCAATGAGCA
AACAGTACAGGTTGATGTCAATCAATTTGAACAAATAGGGAAAGACCGTATCACACGCATTGACAATAGTTGGAAAGAAG
TTATCCACGCTAGTCACTTTCAGGAAATCGGGGAAAACAAGCAGTGTGATATCCAAAATGATTATACCCTGAAAGCCGCA
GGGGGTATCCATACCCATACCAAAATCCACACCTTGCAAGCCAGTGAAACGGTCATTATCAAAGGCAAGGCTGGGTCGAT
TCAATTGGATGCACAAGGTGTGACTATTACAGGTAAAATTCTGCTCAAAGGCGATGTGTCAATAACGGGGGGCGCCCCAG
AAGTGGTTACTCAGTTAGAAGCGGCGGTTAATGAAGGGTTACCATTAGCTGAGGATTGCCGTGCGAAAGCGATGAAAAAA
GGAACGGCCTAA