Detailed information of effector


Summary

Effector ID EFF01122 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (731 a.a.); Nucleotide sequence (2193 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BB2000_RS03995
Coordinates (Strand) 941108..943300 (+)
NCBI ID 529236521
RefSeq NC_022000
Uniprot ID UPI0003843CDE
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 9.3e-59 130..421
Phage_base_V PF04717.14 2.1e-11 480..543

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-730 MLSKDPKSTPIDPASVLKDEAINQVKNRVQSKVNETLSTPTQKVAGMASAAASLTQSASASANRVTAHPLIHGGGFTGGQTFAENQALQAAHGALLDALGMDSLESGLVFTCTIGGLPDDTFQVTEFNLTEGLSSLFSLSISAVSALPFIDFQRHLGLASSLTVKRDGVLIRKVNGILAGAVQGNTDGVKTWYHFDIRPEMWVMTLNQDSRIFQHQSVPTILKTLLDEAHVKADCQFYREDLHPERLYTTQKRESAFDFWCRLAFEEGINFWFEEEQLFYSDEHMGMTAGIHLTYNPQADTDISDSTAMTWQYGEYLCVDETIHKDNNFVRPSYPLSHENKIEQGGQHSVFESYGRFQLDDEGRPLTQVRFEQLRNGSKVGQATTNCFALMPGKIFTLSQHPHQPMNDRWQVISVSHHGVQPLADNSGGEGTQLSNSVSFIPGTQEWRPPYRYKPTADGDEVATVVGPPGEEIYVNEYGAVKVHFHWDRRGSADHSASCWVRVAMGWSGNGYGFSAVPRIGTQVLVSYLNGDIDRPMITGCTYDGRNAPPIKFPENKTQTTFRSQTHKGEGFNELRFEDAGGKQEVFLHAQKDMNTVVQNDKGTTVGANHTETIMQNQKISVHGTQTTAVQADQKNIVFGNQHSIVDGEVLIASAKGIRLISGNSALQLNPDGTITLVCNNFDFYGHGSGRIGTGELLDLNMDGAGPGNLEMKPDTSTIAQAKDQFFPKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5396 - -



  Protein sequence: 731 a.a.    .

>EFF01122 NC_022000:941108-943300 [Proteus mirabilis BB2000]
MLSKDPKSTPIDPASVLKDEAINQVKNRVQSKVNETLSTPTQKVAGMASAAASLTQSASASANRVTAHPLIHGGGFTGGQ
TFAENQALQAAHGALLDALGMDSLESGLVFTCTIGGLPDDTFQVTEFNLTEGLSSLFSLSISAVSALPFIDFQRHLGLAS
SLTVKRDGVLIRKVNGILAGAVQGNTDGVKTWYHFDIRPEMWVMTLNQDSRIFQHQSVPTILKTLLDEAHVKADCQFYRE
DLHPERLYTTQKRESAFDFWCRLAFEEGINFWFEEEQLFYSDEHMGMTAGIHLTYNPQADTDISDSTAMTWQYGEYLCVD
ETIHKDNNFVRPSYPLSHENKIEQGGQHSVFESYGRFQLDDEGRPLTQVRFEQLRNGSKVGQATTNCFALMPGKIFTLSQ
HPHQPMNDRWQVISVSHHGVQPLADNSGGEGTQLSNSVSFIPGTQEWRPPYRYKPTADGDEVATVVGPPGEEIYVNEYGA
VKVHFHWDRRGSADHSASCWVRVAMGWSGNGYGFSAVPRIGTQVLVSYLNGDIDRPMITGCTYDGRNAPPIKFPENKTQT
TFRSQTHKGEGFNELRFEDAGGKQEVFLHAQKDMNTVVQNDKGTTVGANHTETIMQNQKISVHGTQTTAVQADQKNIVFG
NQHSIVDGEVLIASAKGIRLISGNSALQLNPDGTITLVCNNFDFYGHGSGRIGTGELLDLNMDGAGPGNLEMKPDTSTIA
QAKDQFFPKK*

  Nucleotide sequence: 2193 bp    .

>EFF01122 NC_022000:941108-943300 [Proteus mirabilis BB2000]
ATGCTTAGCAAAGATCCGAAATCAACGCCCATTGACCCGGCATCCGTTTTAAAAGATGAAGCCATCAATCAAGTGAAAAA
TAGGGTGCAATCCAAAGTGAACGAAACGCTATCGACACCCACGCAAAAGGTGGCCGGGATGGCCTCAGCAGCGGCCTCGC
TCACTCAATCAGCCAGCGCATCGGCCAATCGCGTGACGGCTCATCCCCTGATCCACGGTGGCGGTTTTACCGGTGGACAA
ACATTCGCTGAAAACCAAGCACTCCAAGCGGCCCATGGGGCGTTACTTGATGCATTAGGCATGGACAGCCTCGAAAGTGG
TTTGGTGTTCACTTGCACCATTGGTGGATTGCCTGACGACACCTTTCAAGTCACCGAATTTAATCTTACCGAAGGATTAT
CCTCGCTATTTTCGCTGTCCATCAGTGCGGTCAGTGCCTTACCCTTTATCGATTTTCAGCGCCATCTTGGCTTAGCCTCA
TCATTAACGGTCAAACGCGATGGGGTGTTGATCCGCAAAGTCAACGGTATCTTAGCCGGGGCAGTACAAGGCAATACCGA
CGGAGTGAAAACGTGGTATCACTTCGATATTCGCCCTGAAATGTGGGTGATGACCCTCAATCAAGACAGCCGTATTTTTC
AACATCAATCGGTGCCGACCATCTTAAAAACCTTATTGGATGAGGCCCATGTTAAAGCGGATTGCCAATTCTACCGTGAA
GATCTACACCCTGAACGTCTCTACACCACCCAAAAACGCGAATCGGCATTTGATTTTTGGTGTCGACTGGCGTTTGAAGA
GGGCATTAACTTCTGGTTTGAAGAAGAACAACTGTTTTACAGCGATGAACATATGGGGATGACGGCGGGTATTCACCTCA
CCTATAACCCGCAGGCCGACACCGATATCAGCGATAGCACTGCCATGACTTGGCAATATGGCGAATATTTGTGTGTGGAT
GAAACTATCCATAAAGACAACAACTTTGTTCGTCCTTCTTATCCGTTGTCTCATGAAAACAAAATTGAGCAGGGGGGACA
GCACAGTGTGTTTGAAAGTTATGGTCGTTTTCAATTAGACGATGAAGGTCGACCTCTGACACAGGTGCGCTTTGAGCAAT
TACGTAACGGCAGCAAAGTGGGGCAAGCGACAACAAACTGTTTTGCGCTGATGCCCGGCAAAATCTTCACCTTATCTCAG
CATCCCCATCAGCCGATGAATGATCGCTGGCAAGTGATCAGCGTCAGCCATCATGGTGTACAGCCACTGGCGGACAATAG
CGGGGGCGAAGGCACACAACTGTCGAATAGCGTCTCCTTTATTCCGGGCACGCAAGAGTGGCGTCCCCCTTATCGTTATA
AACCGACTGCCGACGGCGATGAAGTGGCGACGGTGGTAGGACCGCCGGGGGAAGAAATCTACGTCAATGAATATGGCGCC
GTGAAAGTGCATTTTCATTGGGATCGTCGGGGAAGTGCCGATCACAGTGCTTCATGCTGGGTGCGGGTTGCCATGGGTTG
GAGTGGAAATGGCTATGGTTTTTCTGCGGTACCGCGCATCGGCACACAAGTGCTGGTCAGTTACCTGAATGGGGATATCG
ACAGACCGATGATTACCGGTTGTACCTATGATGGTCGTAACGCACCACCGATTAAGTTCCCAGAGAATAAGACACAAACC
ACTTTCCGTAGCCAAACCCACAAAGGGGAAGGTTTTAATGAACTGCGTTTTGAAGATGCCGGCGGTAAGCAAGAGGTGTT
TCTTCATGCGCAGAAGGATATGAATACCGTAGTCCAAAACGATAAAGGAACGACGGTAGGCGCCAATCATACTGAAACCA
TTATGCAAAACCAAAAGATCTCAGTACATGGTACGCAAACTACGGCGGTTCAAGCGGATCAAAAAAATATCGTGTTTGGT
AATCAACATTCAATCGTGGATGGTGAAGTGTTGATCGCATCAGCCAAAGGTATTCGTTTAATTAGTGGCAACTCGGCACT
TCAATTAAACCCTGACGGGACTATCACCTTAGTGTGTAACAACTTTGATTTTTACGGTCACGGTAGCGGTCGGATTGGTA
CTGGTGAGTTATTAGATTTGAATATGGACGGGGCAGGTCCCGGAAACCTTGAGATGAAACCCGATACTAGCACTATCGCT
CAAGCGAAAGATCAGTTTTTCCCTAAAAAATAA