Detailed information of effector


Summary

Effector ID EFF01121 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BB2000_RS03990
Coordinates (Strand) 940506..941024 (+)
NCBI ID 529236520
RefSeq NC_022000
Uniprot ID UPI00017AFB61
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.7e-35 7..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRFTVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQLIEVSLSYRKIDWEHTVAGTSGADDWRAPLEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9672 - -



  Protein sequence: 173 a.a.    .

>EFF01121 NC_022000:940506-941024 [Proteus mirabilis BB2000]
MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRFTVALNKAVPL
LYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQLIEVSLSYRKIDWEHTVAGT
SGADDWRAPLEA*

  Nucleotide sequence: 519 bp    .

>EFF01121 NC_022000:940506-941024 [Proteus mirabilis BB2000]
ATGCCAACTCCTTGCTATATTTCCATTGAAGGAAAAACTCAGGGCAACATCACTGCAGGCGCGTTTACTGCAGATTCTGT
CGGCAACATTTATGTACAAGGTCATGAAGACCAAATGTTGGTACAAGAATTTTCTCACGTGGTGACGGTTCCGACTGATC
CGCAATCAGGCCAACCTTCTGGCCAACGTGCGCATAAACCGTTTCGTTTTACCGTGGCATTAAACAAAGCCGTTCCTCTG
CTGTATAACGCATTGGCTTCCGGCGAAATGCTGCCAAAAGTTGAGTTAAAATGGTATCGCACGTCTGTTGAAGGTAAACA
AGAGCACTTCTTTACCACCACACTGACTGACGCGACGATCGTGAACATCGATTGCCAAATGCCTCATTGTCAAGATCCGG
CTAAAGCCGACTTCACGCAACTTATCGAAGTTTCCCTCTCTTACCGCAAAATTGACTGGGAGCACACTGTTGCTGGAACG
TCTGGTGCGGATGACTGGCGTGCGCCTCTCGAAGCGTAA