Detailed information of effector


Summary

Effector ID EFF01036 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (1318 a.a.); Nucleotide sequence (3954 bp)
Description Tse5
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2684 (Tse5)
Coordinates (Strand) 3031749..3035702 (-)
NCBI ID 15597880
RefSeq NC_002516
Uniprot ID TSE5_PSEAE
KEGG ID pae:PA2684
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
RHS PF03527.16 4.6e-15 1065..1102
DUF6531 PF20148.1 1e-13 46..120
RHS_repeat PF05593.16 5.2e-08 489..524
RHS_repeat PF05593.16 1.4e-06 531..566
RHS_repeat PF05593.16 3.5e-06 595..630
RHS_repeat PF05593.16 5.3e-06 636..670
RHS_repeat PF05593.16 8.1e-05 927..965

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1317 MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPDTFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRRGGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGLLTGVRDSAGRSYALVYQQACEPSEGDDGLRLFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIAVRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPHGRVVKQIEAGGLTRTFRYLRDATEVSDSLGRVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYRKRVDEETGLLVELEDAMQRRWTFERDERGNATTVRGPAGSTRYAYEDPRLPDRPTRIVDPRGGERRLEWNRFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTRIADAEGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGRRQRYRYNAADELIAREDADGRETTYAYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVRYTYDEVGNLRLESQVHADGWVYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERDALHREVRRDARRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRYEYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEHAREDARQAFAENELYRSGFSRSETRASQAGEGPARWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRDYADGTRLEARYRYDALSRRIAKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQLRQAFAAEGQPLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEESGLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGAGIELGMQTGKQVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRTLSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9318 - -



  Protein sequence: 1318 a.a.    .

>EFF01036 NC_002516:c3035702-3031749 [Pseudomonas aeruginosa PAO1]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPDTFTFARGYLS
SNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRRGGSSGGEAQAWRGRWAAVPA
ELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGLLTGVRDSAGRSYALVYQQACEPSEGDDGLR
LFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIAVRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPH
GRVVKQIEAGGLTRTFRYLRDATEVSDSLGRVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRR
RRDGQGRMLEEESPGKARYRKRVDEETGLLVELEDAMQRRWTFERDERGNATTVRGPAGSTRYAYEDPRLPDRPTRIVDP
RGGERRLEWNRFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTR
IADAEGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGRRQRYRYNAAD
ELIAREDADGRETTYAYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVRYTYDEVGNLRLESQVHADGW
VYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERDALHREVRRDARRDGQDDALFTQERQHAPLG
RLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRYEYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEHARED
ARQAFAENELYRSGFSRSETRASQAGEGPARWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRD
YADGTRLEARYRYDALSRRIAKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQ
LRQAFAAEGQPLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEES
GLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGAGIELGMQTGK
QVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRTLSGQAANTANRAAKLAARKA
AHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ*

  Nucleotide sequence: 3954 bp    .

>EFF01036 NC_002516:c3035702-3031749 [Pseudomonas aeruginosa PAO1]
ATGAGCGGCCTACCGGTTTCCCATGTCGGCGAGAAAGTCTCGGGAGGGGTTATCTCCACCGGCTCGCCCACCGTGCACGT
CGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCCGCCTGCGTGCCGTTGGTGGGCAAGCCGGTCAACCCGATGCTCG
GCAGCAAGCTGCTGCCGGAAGAGGTCGATTTCGCCCTGGCGGCGCCGGACACCTTCACCTTCGCCCGTGGCTACCTGTCG
AGCAACCCCCGTATCGGCCGGCTCGGCCGGGGCTGGTGGCTGCCGGGCGAGAGCATGCACCTGGAACTGAGCGAAGACGC
CTGCGTGCTGGTCGACGCCCAGGGCCGCCGGATCGGCTTTCCTGCGCTGGCTCCCGGCGCCCAGCATTATTCCGGCAGCG
AGGAGCTGTGGCTGCGCCGCGGCGGTTCGAGCGGCGGCGAAGCGCAGGCCTGGCGCGGGCGCTGGGCGGCGGTGCCGGCC
GAACTGCAGACGCAGGAGGGCTCCGTGCTGGTGCTGTCCGGCCACAGCTACCTGCATTTCCAGCGTTGCCCCGACGGTAT
CTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGCACCGAGTTCCGCTGGAGCGGACGTGGCCTGCTCACCGGCG
TGCGCGACAGCGCCGGGCGCAGCTATGCGCTGGTCTACCAGCAAGCCTGCGAGCCGAGCGAGGGCGACGACGGCCTGCGT
CTGTTCGGCGTGATCCTGGCCAGCCACGACGGACCGCCTCCGGACTACATCGATCCGCAGAGCCCGGGGCTCGACTGGCT
GGTGCGCTACCAGTTCAGCGACAGCGGCGATCTGATCGCCGTGCGCGACCGTCTTGGCCAGGTGGTCCGGGTATTCGCCT
GGCGCGAGCACATGCTGGTCGCCCACGGCGAACCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCTCCGCAC
GGGCGGGTCGTGAAGCAGATCGAGGCGGGCGGCCTGACCCGTACCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGA
CAGCCTCGGCCGCGTCGAACGCTACGAGTTCGCCGGCGAGGGCGGGCAGCGGCGCTGGACCGCGCTGGTCAGGGCCGACG
GCAGCCGTAGCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCATGCGCGATCCGCTGGGACGGGAGACGCGGCGC
CGGCGCGATGGCCAGGGGCGGATGCTCGAGGAGGAGTCGCCGGGCAAGGCGCGCTATCGCAAGCGCGTCGACGAAGAGAC
CGGGCTGCTGGTCGAGCTGGAGGACGCGATGCAGCGCCGCTGGACCTTCGAGCGCGACGAACGGGGCAATGCGACGACGG
TGCGCGGCCCGGCCGGCAGCACCCGCTACGCCTACGAAGACCCGCGCCTGCCCGACCGGCCGACGCGAATCGTCGACCCG
CGCGGCGGCGAGCGGCGCCTGGAGTGGAACCGCTTCGGCCTGTTGGCCGCGTTGACCGATTGTTCCGGCCAGGTCTGGCG
TTACGACTACGACAACGAAGGACGTTTGGTCGCCAGCAGCGACCCGCTGGGACAACTGACCCGGCGCCGCTACGACCCGC
TGGGGCAACTGATCGGCCTGGAATTGGCCGACGGCAGCGCCCTGAGCTATGAATACGACGCCCTTGGGCGGCAGACCCGT
ATCGCCGATGCCGAGGGGCACGCCACGCTGTTTTCCTGGGGGCACGGCGATCTGCTGGCGCGGGTTTCCGACGCCGGCGG
CGGCGAATTGTCCTACCTGCACGACGAAGCCGGCAGGCTGGTCGCCCTGACCAACGAGAACGGCGTCCAGGCGCAGTTCC
GCTACGACCTGCTGGACCGTCTGGTGGAAGAGACCGGCTTCGACGGTCGTCGCCAACGCTATCGCTACAACGCCGCTGAC
GAACTGATCGCCCGCGAGGATGCCGACGGTCGCGAGACCACCTATGCCTACGACCGCGACGGCCGCCTGGCGAGCATCCG
GGTTCCCGCCACCGAGCACGCACCGGCCCTGGTCGAGCGTTACCGCTGGTTGGCCGACGGCCGCCTGGCCAGCGCCGGCG
GGGCGGATTGCGAGGTGCGCTACACGTACGACGAGGTCGGTAACCTGCGCCTGGAAAGCCAGGTACATGCCGACGGTTGG
GTCTACAGCGTCGAGCACAGCCACGACGCGCTAGGCGTGCGCCAGACCAGCCGCTACGGCGACGCGCCGCCGGTCGCCTG
GCTGACCTATGGCCCGGGTCATCTGCACGGCGCGCTGGTCGGTGCGGTCGAGCTGGCCTTCGAGCGCGATGCCCTGCACC
GTGAGGTGCGTCGCGACGCCCGCCGCGACGGGCAGGATGACGCGTTGTTCACCCAGGAGCGCCAGCACGCGCCGCTGGGA
CGCCTGCAGCGCAGCCGCCTGCGTCTGGCCGGCGGTTTCGACTGGCAGCGCGGCTATCGCTACGACGGACTTGGACAACT
GGTCGGCATCGACGACAACCAGTATCCGTCGGTGCGCTACGAATACGACCTCGGCGGTCGCCTGCTGGCCAGCCGGCGCG
CTGGCGCGGCGGCCAGCACCTACCGCTACGATGCCGCCGGCAACCGCCTGGAGGGCGTCGGCGAGCACGCGCGCGAGGAC
GCTCGCCAGGCATTCGCCGAGAACGAACTGTACCGCTCCGGTTTCAGTCGCTCCGAGACGCGCGCGAGCCAGGCCGGCGA
AGGCCCGGCGCGCTGGGCCGGCAACCGCGTGGAGAGGATCGCCGGCAACCGCTATCGCTTCGATGCGCTGGGCAACCTGG
TCGAGCGTATCGGCGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGTCCATCTGACGCGCGAT
TACGCCGACGGTACGCGGCTGGAGGCGCGCTACCGCTACGACGCGCTGTCGCGACGGATCGCCAAGGTGGTGCTGCGCGA
CGGTGTCGAGCAGCAGGTGCGCTTCGGTTGGGACGGCGATCGCCAATGCGCCGAAGCCTTTGCGCGGGAACTGCGCACCA
CCGTTCACGAACCGGGCGGTTTCGTCCCGTTGCTGCGCCTGGAGCAGGCCTGCGAGCCCGATCCCCCGGAGCTGCTGCAA
CTGCGCCAGGCGTTCGCCGCCGAAGGCCAGCCGCTGCCGGCGCAATGCGTGCCGGCGCTGGGCGAGGCGCGGATCGCTTT
CTTCCACACCGATCACCTCGGTACCCCCCTGCAGCTGAGCGACGAACGTGGCCAACTGCGTTGGCAGGGCGTTCCGGACG
ACTGGCGGGCGGTAGCGCCGGAACGACAGCCGGGTGCGCAGCCGATCCGCTTCCAGGGGCAGTACCACGATGAGGAAAGC
GGCCTCTACTACAACCGCTACCGTTACTACCTGCCGGAAGCCGGGCGCTATGCCAGCCAGGACCCGCTCGGCCTGGGCGG
TGGCCCCAACCCCTATGCCTACGCGCTGAACGCGCCCACGCTGGCCTACGATCCCACCGGCCTGATCATCCCGCTGGTGG
TGATCGGCGCCTTCGCCGCCCGCGCCGCGATCGGAGCGGCGCTGGGCGCCGGCATCGAGCTGGGGATGCAGACCGGCAAG
CAGGTGCTGGGGCAGATGAAGGACAACTGGGACAGCGATCGCGACCTCACCGATATCAAGTGGAAGTGCATCGACATCAA
CTGGAAACACGTCGGCGCCTCGGCGGCCATCGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACCGTGGTGCAGT
CCGCCAAGGCGATCAGGACCCTTTCCGGACAGGCGGCCAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCC
GCCCATGCCGATACCATCAAGAAGGCCGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAATGCCCACT
GAAGGACGAAGAAGAGGAGTGTCCGCCGCAATGA