Detailed information of effector


Summary

Effector ID EFF01019 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00793 experimental (Type i1)
Strain Vibrio alginolyticus strain EPJS
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VEPGS_0021 (hcp1)
Coordinates (Strand) 27427..27945 (-)
NCBI ID 225382164
GenBank FJ790776
Uniprot ID B1PDM0_VIBAL
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 6.4e-31 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGTAGNDDWRAPREA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9660 - -



  Protein sequence: 173 a.a.    .

>EFF01019 FJ790776:c27945-27427 [Vibrio alginolyticus]
MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPL
LFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGT
AGNDDWRAPREA*

  Nucleotide sequence: 519 bp    .

>EFF01019 FJ790776:c27945-27427 [Vibrio alginolyticus]
ATGCCAACTCCAGCATATATGTCTATCCAAGGTGAGACTCAAGGCCATATTACTAAAGATACTTACTCTGCAGATTCAGT
AGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGTGCTAACTGTTCCACGTGATC
CACAAAGTGGTCAGCCAACTGGTCAACGTGTACACCGTCCACTTGTTGTAACTAAAGTTCAAGATCGCTCATCTCCACTA
CTATTCAACGCACTAGTATCTGGCGAAAAACTTCCTGAGTGTGTGATCCGCTTCTACCGTACTTCAGTTCAAGGTAAACA
AGAGCACTACTACTCAATCAAATTGATTGATGCGCTACTTGTCGATATCCAAACTCGTATGAACCACTGTCAAGACGCAG
CAACAGCTGACCGCGTGACAGAAGAAGTGCTTAAGTTCACTTACCGTGCGATCGAAGTAACTCACGAAAACTGTGGTACT
GCGGGTAACGACGACTGGCGTGCTCCACGCGAAGCTTAA