Detailed information of effector


Summary

Effector ID EFF01010 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (219 a.a.); Nucleotide sequence (657 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS01015
Coordinates (Strand) 211606..212262 (-)
NCBI ID WP_001223375.1
RefSeq NZ_KQ410497
Uniprot ID UPI00005F4E9B
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VasI PF11319.10 1.1e-54 37..218

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-218 MRITVLVASLILGCAGSAHVFAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQVAIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASEPRLLLRSNAPFADGLQFDTRGVNEALDALRERCGW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.7203 pos: 22-23. VFA-AS. MRITVLVASLILGCAGSAHVFA



  Protein sequence: 219 a.a.    .

>EFF01010 NZ_KQ410497:c212262-211606 [Vibrio cholerae V52]
MRITVLVASLILGCAGSAHVFAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQVAIAPSNPYPAEWQRAMAAL
SESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEVADARIQVSIRHETQFWRSDD
HGVLFSSARGMPAIEMMKLAASEPRLLLRSNAPFADGLQFDTRGVNEALDALRERCGW*

  Nucleotide sequence: 657 bp    .

>EFF01010 NZ_KQ410497:c212262-211606 [Vibrio cholerae V52]
ATGAGAATTACCGTTTTAGTGGCCAGTTTGATCTTGGGTTGCGCGGGCTCTGCGCATGTTTTTGCAGCATCGCAAGATGC
GGGATCGCAGGTTGAGCAAGCTGAGCTGTGCCGCGAAATTCCTGCGCGTTTAGAGCGTTTGGCTTGTTTTGACCGTGTCT
TTGCCACGCCCCTTGAGCAAGTGGCTATCGCACCGTCCAATCCTTATCCCGCAGAGTGGCAACGCGCCATGGCGGCATTG
TCTGAGTCGCAGTCCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCC
TGCGCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGCATTGAGC
TGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGTTCTGGCGCAGTGACGAT
CACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAAATTGGCCGCCAGTGAGCCTCGCCTGTT
GCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGATACTCGAGGTGTCAATGAAGCCCTTGATGCTTTGCGCG
AACGCTGTGGTTGGTAA