Detailed information of effector


Summary

Effector ID EFF00961 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00086 experimental (Type i4b)
Strain Pseudomonas syringae pv. syringae B728a
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PSYR_RS25780
Coordinates (Strand) 5889737..5890255 (+)
NCBI ID 66048189
RefSeq NC_007005
Uniprot ID Q4ZLI0_PSEU2
KEGG ID psb:Psyr_4965
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.4e-40 6..145

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEFGATQATSATASSSGGASSERVALSDFSIRKSVDKASAKLFEACCKGTHIAKIQLNVNRAGGDKLTYLTINLEEVVVSSVKAVAGGSQKGEDNAVSDLPIEEISFNFARIKTTYTQQSRSDGQGGGNVTGGWDRTANKVFA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9477 - -



  Protein sequence: 173 a.a.    .

>EFF00961 NC_007005:5889737-5890255 [Pseudomonas syringae pv. syringae B728a]
MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEFGATQATSATASSSGGASSERVALSDFSIRKSVDKASAKLFEACCKGTH
IAKIQLNVNRAGGDKLTYLTINLEEVVVSSVKAVAGGSQKGEDNAVSDLPIEEISFNFARIKTTYTQQSRSDGQGGGNVT
GGWDRTANKVFA*

  Nucleotide sequence: 519 bp    .

>EFF00961 NC_007005:5889737-5890255 [Pseudomonas syringae pv. syringae B728a]
ATGGCATTTGACGCATACATCCAAATCGATGGCATCCCAGGCGAAGTTCTGGACGACAAGCACAAGGACTGGATCGAAGT
GTTGGGCTACGAGTTCGGCGCTACCCAGGCCACCTCGGCGACCGCCAGTTCTTCGGGCGGTGCTTCGTCCGAGCGCGTTG
CACTGAGCGACTTCAGCATCCGCAAGTCTGTGGACAAGGCTTCCGCCAAGCTGTTCGAAGCGTGCTGCAAGGGCACTCAC
ATCGCCAAGATCCAGCTGAACGTCAACCGTGCAGGCGGCGACAAGCTGACCTACCTGACCATCAACCTGGAAGAAGTGGT
TGTGTCTTCCGTGAAGGCGGTTGCTGGCGGTAGCCAGAAAGGCGAAGACAACGCAGTCAGCGATCTGCCGATTGAAGAAA
TCAGCTTCAACTTCGCTCGCATCAAGACCACCTACACCCAGCAGAGCCGTTCCGATGGCCAGGGTGGCGGTAACGTCACT
GGCGGCTGGGACCGCACTGCGAACAAAGTATTCGCATAA