Detailed information of effector


Summary

Effector ID EFF00562 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00466 experimental (Type ii)
Strain Francisella tularensis subsp. holarctica LVS
Replicon chromosome
Sequence Protein sequence (384 a.a.); Nucleotide sequence (1152 bp)
Description IglI
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) FTL_0118 (IglI)
Coordinates (Strand) 112168..113319 (-)
NCBI ID 89255555
RefSeq NC_007880
Uniprot ID UPI000049C512
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-383 MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9965 - -



  Protein sequence: 384 a.a.    .

>EFF00562 NC_007880:c113319-112168 [Francisella tularensis subsp. holarctica LVS]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNLDTVDNISKII
SSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDF
KIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNF
FYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI*

  Nucleotide sequence: 1152 bp    .

>EFF00562 NC_007880:c113319-112168 [Francisella tularensis subsp. holarctica LVS]
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTAATATGCAAAT
ACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCTTAATACTACTAGAAGCATAG
ATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTAGATACGGTTGATAATATCTCTAAAATTATT
AGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAATTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGA
AAAAGGAATAAACAAATTCTTAGTCACTATGGATGCAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTACCAAATA
ACATAGATTCTATTATAGAAATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAACTTAAATTATAATTCTGATTTT
AAAATCCAACTAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATTCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGGAAAACTCTTA
TTGAAAAAATTGAAGTTTTAAAAGCTCTAGTTGAAAGTGAAAGAATATTTGAAACATCTATTGTTTATAATGATATACAA
AACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTTTCCATTATACAAGAAGATAGCTCCTTTTAT
TGGCAATATCCATAAAAACATAGACTACTACTCATCAAGTATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATT
ATAAGAGTTTTCTAGATACTCTTGAGAAAATGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTC
TTTTATGAAACATCCTCAGAGGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGA
AGAAATAGTAATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGACCCCGTAGAAAAAATTTCAAATAAAATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA