Detailed information of effector


Summary

Effector ID EFF00561 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (169 a.a.); Nucleotide sequence (507 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_4564 (AaiC)
Coordinates (Strand) 4895043..4895549 (+)
NCBI ID 387609980
RefSeq NC_017626
Uniprot ID UPI0001887CE4
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-168 MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHIQDLLENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSIEMNIPSDDGKSTEKLGPMTYNLYKEALV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9250 - -



  Protein sequence: 169 a.a.    .

>EFF00561 NC_017626:4895043-4895549 [Escherichia coli 042]
MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHIQDLLENFFKR
GEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSIEMNIPSDDGKSTEKLGPMTY
NLYKEALV*

  Nucleotide sequence: 507 bp    .

>EFF00561 NC_017626:4895043-4895549 [Escherichia coli 042]
ATGGTCGGAGTTATGAGTAATTCTTCTGCTCTTAGCAGGGAGTTTGTCAAAATAGAGATAGGTGGAAAAGTTATAAAGGG
AAATTCAAAAGTTGAAAACAGTGGTGACTACTTTGATGGACATTGTCCTCAGGCATTTCACGCTTTTTCAGGAATTGACG
GTACTGTTTTTGATTTAATTAATTTGAAGCTTAGGGTTACTAAACACATACAAGACCTTCTGGAGAACTTTTTTAAGAGA
GGTGAAAAAGAAGTTAAAATAGAAATTTTACGTAGGGAATCAACTAAATCAGGTAGTGCATACTCATCATTTAAGGTTGT
TTATCAGGGGTGTCGTATGCATAATATGTTGTTGGCTCATGATAATGATTCAAATCTCATTCTGGAATTGTCGTTTACCC
CAGAAGAGAGTGTCTCAATTGAGATGAATATTCCGTCAGATGATGGAAAAAGTACGGAGAAATTGGGACCAATGACGTAC
AACTTATATAAAGAGGCTCTTGTATAA