Detailed information of effector


Summary

Effector ID EFF00560 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00463 experimental (Type i2)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_RS24195
Coordinates (Strand) 4858680..4859171 (+)
NCBI ID 387609950
RefSeq NC_017626
Uniprot ID UPI0001887D17
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 6e-37 6..146

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKNPAYEKHNHLEQVELRYEKITWTYKDGNIIHSDAWSERTTA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9879 - -



  Protein sequence: 164 a.a.    .

>EFF00560 NC_017626:4858680-4859171 [Escherichia coli 042]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSPYLYKAVTTGQ
TLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKNPAYEKHNHLEQVELRYEKITWTYKDGNIIHSDAWSER
TTA*

  Nucleotide sequence: 492 bp    .

>EFF00560 NC_017626:4858680-4859171 [Escherichia coli 042]
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGATGATGGCGGTGCAGATATCAAAGGGTCCGTGGATGTTCAGGACCGTGA
GGGCAGCATTGAGGTGGTGGCTCAGGAGCACTGCCTCTACATCCCGACGGATAACAATACCGGTAAGCTGACCGGTACCC
GTATTCACACGCCGTTTCTGTTTACCAAGGAAATTGATTCTTCCAGCCCGTACCTTTACAAGGCCGTGACCACCGGGCAG
ACCCTGAAGTCTGCTGAGTTTAAGTGGTACAAAATCAATGATGCCGGTCAGGAGGTGGAGTATTTCAATACGAAGCTTGA
GAACGTGAAGGTGGTGAAGGTTAACCCGGTCATGCACGACATCAAGAATCCCGCTTACGAGAAGCATAACCACCTTGAGC
AGGTGGAACTGCGCTACGAGAAAATCACCTGGACTTACAAGGACGGCAACATCATTCATTCCGACGCATGGAGTGAGCGT
ACCACCGCGTAA