Detailed information of effector


Summary

Effector ID EFF00505 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00395 experimental (Type i3)
Strain Enterobacter cloacae subsp. cloacae ATCC 13047
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECL_01541 (hcp)
Coordinates (Strand) 1562931..1563413 (+)
NCBI ID 495778061
RefSeq NC_014121
Uniprot ID W7PMH0_9ENTR, A0A0J6QBZ6_9ENTR, A0A1S2AGP3_9ENTR, A0A1M5IMD7_9GAMM, A0A0F1B2S9_9ENTR, A0A2S4SQA5_9ENTR, A0A2U3F0D5_9ENTR, A0A1J5WMM3_9ENTR, A0A126PNA0_ENTCL, A0A0E3AAP6_ENTAS, A0A0H3CHH7_ENTCC, A0A2J7S2P4_9ENTR
KEGG ID ern:BFV67_12850, lni:CWR52_21975, ecls:LI67_012800, eclg:EC036_26020, enc:ECL_01541
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 7.7e-37 6..131

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAILKHCASGKHLTKVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTTSGGKGAESSAGWNIKENKEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9458 - -



  Protein sequence: 161 a.a.    .

>EFF00505 NC_014121:1562931-1563413 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAILKHCASGKHLT
KVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTTSGGKGAESSAGWNIKENKEA
*

  Nucleotide sequence: 483 bp    .

>EFF00505 NC_014121:1562931-1563413 [Enterobacter cloacae subsp. cloacae ATCC 13047]
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCTGGACTGATAT
TACCTCCTTCTCCTGGGGCGCTTCCCAGCCAGGTAATATGAGCGTTGGCGGTGGCGGCGGTGCCGGTAAAGTTAACTTTA
ACGATCTGCACGTTAACGCTCTGATCGACAAATCCACCACAGCAATTCTGAAACACTGCGCCAGCGGTAAACACCTGACC
AAAGTTGAGCTGTCCGTCTGTAAAGCCGGTGGCCAGCAGGTGGAATACTCTCGCATTACCCTGGAAGACGTTCTGGTAAC
GTCTGTTCAGTACACCGGTGCAGACAACGGCGATACCGTTGGTGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGC
AGTACTGGGAGCAGACCACCTCTGGTGGTAAAGGTGCTGAAAGCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCA
TAA