Detailed information of effector


Summary

Effector ID EFF00479 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ETAE_RS11250
Coordinates (Strand) 2557455..2557946 (+)
NCBI ID 269139776
RefSeq NC_013508
Uniprot ID UPI00003BF63C
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 2.8e-32 6..137

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVTKWMDCASVKLASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSDRPQETIDFAYKEVTWEYVPQDQNGKAGGKIGPEGWSLITNKKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9782 - -



  Protein sequence: 164 a.a.    .

>EFF00479 NC_013508:2557455-2557946 [Edwardsiella tarda EIB202]
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVTKWMDCASVKLASAAVQGQNF
PTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSDRPQETIDFAYKEVTWEYVPQDQNGKAGGKIGPEGWSLITN
KKK*

  Nucleotide sequence: 492 bp    .

>EFF00479 NC_013508:2557455-2557946 [Edwardsiella tarda EIB202]
ATGGCTTTTGATACTTATATCAAACTGGATAAGGTTGATGGGGAATCCACCGACGATAAGCACAAAAAATGGATTGAAGT
GCTGGGTTTTGCCTGGGGAGCCGGCAATGAATGCACGATGGAGAGCGGCACCCAGGGGCTGAATACCGGTAAGGCGATGA
TGTCGGTGCTGCGTGTCACCAAATGGATGGACTGCGCCAGTGTCAAGCTGGCCTCCGCCGCCGTGCAGGGGCAGAACTTT
CCCACGCTGGAGCTGGAGATTTGCACCCAGGCGGGCGATAAGTTCGCCTTCTGCATCTACAAATTTACGCATGTCGCCGT
CTCCAGCTATCAATGCTCAGGGGCCACGGGCGGCAGCGATCGCCCGCAGGAAACCATTGATTTCGCTTATAAAGAAGTGA
CCTGGGAATACGTTCCCCAGGATCAGAACGGCAAGGCGGGCGGCAAAATTGGTCCTGAGGGCTGGAGCCTGATTACCAAC
AAGAAAAAGTAA