Detailed information of effector


Summary

Effector ID EFF00478 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (187 a.a.); Nucleotide sequence (561 bp)
Description EvpP inhibits neutrophils recruitment through Jnk-caspy-inflammasome cascades in vivo.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ETAE_RS18215
Coordinates (Strand) 2554576..2555136 (+)
NCBI ID 269139773
RefSeq NC_013508
Uniprot ID UPI0001BD08F7
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-186 MTLNSELEWSDVGSICTDQKAKTYVSDAFNIAYGQPTKELLPAGTALYKFNGFSSLARSPITDDSPLSPWWSPVQPFRYDGGLRQRMLIAKQNGVSMREWGRLTSVIKENWSSLDFLLEIVLKIPVYAWFGGFKGMSRIDNGMTSKRNITLEQKGRSSMLPGGATQFYIPNLTVGHISSHQFSILK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9802 - -



  Protein sequence: 187 a.a.    .

>EFF00478 NC_013508:2554576-2555136 [Edwardsiella tarda EIB202]
MTLNSELEWSDVGSICTDQKAKTYVSDAFNIAYGQPTKELLPAGTALYKFNGFSSLARSPITDDSPLSPWWSPVQPFRYD
GGLRQRMLIAKQNGVSMREWGRLTSVIKENWSSLDFLLEIVLKIPVYAWFGGFKGMSRIDNGMTSKRNITLEQKGRSSML
PGGATQFYIPNLTVGHISSHQFSILK*

  Nucleotide sequence: 561 bp    .

>EFF00478 NC_013508:2554576-2555136 [Edwardsiella tarda EIB202]
TTGACTTTGAATTCCGAGCTGGAATGGTCCGATGTTGGAAGCATTTGTACAGATCAAAAGGCAAAAACCTACGTCAGCGA
TGCATTTAACATAGCCTATGGGCAGCCGACGAAAGAGCTGCTCCCGGCGGGAACAGCCTTATACAAATTCAATGGATTTA
GTTCATTGGCAAGGTCCCCGATCACTGACGATAGCCCGCTATCTCCCTGGTGGAGCCCGGTCCAGCCATTCCGGTACGAT
GGCGGTCTGCGCCAGCGTATGCTGATCGCTAAGCAAAACGGGGTATCAATGAGGGAATGGGGACGACTCACCTCCGTGAT
CAAAGAAAACTGGAGCTCTCTCGACTTTTTACTTGAGATAGTCCTAAAGATTCCCGTCTATGCCTGGTTCGGTGGATTTA
AGGGCATGTCGCGCATTGATAATGGTATGACCTCTAAACGAAATATCACGCTGGAACAAAAAGGCCGGAGCTCAATGCTC
CCCGGCGGGGCCACACAGTTCTATATTCCAAACCTGACGGTCGGGCATATCAGTAGCCACCAATTTTCAATATTGAAATA
G