Detailed information of effector


Summary

Effector ID EFF00434 experimental
Effector type Tge
Cognate immunity protein IMU00074 experimental
Related T6SS (Type) T6SS00035 experimental (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Sequence Protein sequence (178 a.a.); Nucleotide sequence (534 bp)
Description Tge2; Muramidase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PFL_3037 (Tge2)
Coordinates (Strand) 3502760..3503293 (-)
NCBI ID 70730402
RefSeq NC_004129
Uniprot ID UPI000054D6E4
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Glucosaminidase PF01832.22 6.5e-06 49..120

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-177 VGPGLLYNHAAKTAVNGIDRSTEGTNVSARLCNNISAVTFVSKYKAVCQPIADQLDLPVENLLGLAAQESQYGTGRIARELNNYFSMHAPAPLQIGAEAPLGNASIKVAKFDSFQKSAQSFASSFGTAVRGQRDPMAFAQALVRSGYNTGNAKTGGRDGFARYLADIIIAVRGRMAC



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9449 - -



  Protein sequence: 178 a.a.    .

>EFF00434 NC_004129:c3503293-3502760 [Pseudomonas protegens Pf-5]
VGPGLLYNHAAKTAVNGIDRSTEGTNVSARLCNNISAVTFVSKYKAVCQPIADQLDLPVENLLGLAAQESQYGTGRIARE
LNNYFSMHAPAPLQIGAEAPLGNASIKVAKFDSFQKSAQSFASSFGTAVRGQRDPMAFAQALVRSGYNTGNAKTGGRDGF
ARYLADIIIAVRGRMAC*

  Nucleotide sequence: 534 bp    .

>EFF00434 NC_004129:c3503293-3502760 [Pseudomonas protegens Pf-5]
GTGGGCCCCGGGTTGCTTTATAATCACGCGGCGAAAACCGCAGTAAATGGAATTGACCGGTCAACCGAGGGAACAAACGT
GAGCGCCAGACTCTGCAACAACATCAGTGCCGTGACCTTTGTCAGCAAGTACAAGGCGGTGTGCCAGCCGATTGCCGACC
AGCTGGACCTGCCGGTGGAAAACCTGCTGGGCCTGGCCGCCCAGGAAAGCCAGTACGGCACCGGGCGCATTGCCCGGGAA
CTGAACAACTACTTTTCCATGCACGCACCGGCCCCCCTGCAGATCGGCGCCGAGGCGCCCCTGGGCAACGCCAGCATCAA
GGTGGCCAAGTTCGACTCCTTCCAGAAGTCCGCCCAGTCCTTTGCTTCGAGCTTTGGCACGGCAGTACGTGGCCAGCGTG
ACCCCATGGCATTCGCCCAGGCGCTGGTACGCAGCGGCTACAACACCGGCAACGCCAAGACCGGCGGCCGGGATGGCTTC
GCCCGCTACCTGGCGGACATCATCATCGCGGTCAGAGGGCGCATGGCGTGCTGA