Detailed information of effector


Summary

Effector ID EFF00433 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00346 experimental (Type i4b)
Strain Edwardsiella ictaluri 93-146
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) NT01EI_RS11900
Coordinates (Strand) 2633808..2634299 (+)
NCBI ID 238920627
RefSeq NC_012779
Uniprot ID UPI0001A5AB85
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.2e-32 6..137

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MAFDTYIKLDKVDGESTDAKHKKWIEVLGFAWGAGNECSMESGTQGLNTGKATMSVFRITKWMDCASVKLASAAVQGQNFPSLEVEICTQAGDKFAFCIYKFTNVAISSYDCSGASGGSDRPQETIDFAYKEVTWEYIPQDQSGKAGSKIGPEGWSLITNQKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9656 - -



  Protein sequence: 164 a.a.    .

>EFF00433 NC_012779:2633808-2634299 [Edwardsiella ictaluri 93-146]
MAFDTYIKLDKVDGESTDAKHKKWIEVLGFAWGAGNECSMESGTQGLNTGKATMSVFRITKWMDCASVKLASAAVQGQNF
PSLEVEICTQAGDKFAFCIYKFTNVAISSYDCSGASGGSDRPQETIDFAYKEVTWEYIPQDQSGKAGSKIGPEGWSLITN
QKK*

  Nucleotide sequence: 492 bp    .

>EFF00433 NC_012779:2633808-2634299 [Edwardsiella ictaluri 93-146]
ATGGCTTTTGATACCTATATCAAACTAGATAAGGTTGATGGGGAATCTACTGATGCTAAGCACAAAAAATGGATTGAAGT
ACTGGGCTTTGCATGGGGAGCAGGCAATGAGTGCTCAATGGAGAGCGGTACCCAGGGTCTGAATACCGGTAAGGCCACAA
TGTCGGTATTCCGTATAACCAAATGGATGGACTGCGCCAGTGTCAAGCTGGCCTCGGCCGCCGTTCAGGGCCAGAACTTT
CCCTCGCTGGAAGTGGAGATTTGTACCCAGGCTGGCGATAAGTTCGCCTTCTGTATCTATAAATTTACTAATGTAGCCAT
CTCCAGCTATGACTGCTCCGGGGCCTCTGGCGGAAGCGACCGCCCGCAGGAAACCATTGATTTCGCCTATAAGGAAGTGA
CTTGGGAATATATTCCCCAGGATCAGAGCGGTAAGGCGGGCAGTAAAATTGGGCCCGAGGGCTGGAGTCTTATTACCAAC
CAGAAGAAGTAA