Detailed information of effector


Summary

Effector ID EFF00430 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00343 experimental (Type i4b)
Strain Burkholderia glumae BGR1
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description Consequently, the high expression level of tssD1 suggests that B. glumae BGR1 recognizes external stimuli such as the presence of E. coli as prey, and activates the T6SS group_1, which is involved in the antibacterial effect.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BGLU_RS01955
Coordinates (Strand) 403385..403888 (+)
NCBI ID WP_012734481.1
RefSeq NC_012724
Uniprot ID A0A2J9HDV2_BURGL, A0A0B6RHW2_BURPL, C5AA67_BURGB
KEGG ID bpla:bpln_1g03500, bgl:bglu_1g03910, bgp:BGL_1c03600
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 4.6e-41 5..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MLDIYLNFGNPAIKGESQDKDHSGWIELKSWDWSVTQPRSATSSTSGGHTAERCEHSDMVFTKELDMASPLLYQHASGGTTFDEVSIDFMRSDGDGKRVKYLEIKLKYVIISSVTPSVQKEGLPVEQFSLKYAAVQWKQTKQNIGGNQGGNTQGAWSLTKNDKTYAV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9807 - -



  Protein sequence: 168 a.a.    .

>EFF00430 NC_012724:403385-403888 [Burkholderia glumae BGR1]
MLDIYLNFGNPAIKGESQDKDHSGWIELKSWDWSVTQPRSATSSTSGGHTAERCEHSDMVFTKELDMASPLLYQHASGGT
TFDEVSIDFMRSDGDGKRVKYLEIKLKYVIISSVTPSVQKEGLPVEQFSLKYAAVQWKQTKQNIGGNQGGNTQGAWSLTK
NDKTYAV*

  Nucleotide sequence: 504 bp    .

>EFF00430 NC_012724:403385-403888 [Burkholderia glumae BGR1]
ATGTTAGATATCTATCTCAATTTCGGTAACCCGGCCATCAAGGGCGAGTCGCAGGACAAGGACCACTCGGGCTGGATTGA
ACTCAAGTCATGGGACTGGTCGGTCACGCAGCCGCGCTCGGCCACCTCGTCCACCTCGGGCGGCCACACCGCCGAGCGCT
GCGAACACAGCGACATGGTGTTCACGAAAGAGCTCGACATGGCGAGCCCGCTGCTGTACCAGCACGCATCGGGCGGCACG
ACCTTCGACGAAGTGTCGATCGACTTCATGCGTTCGGACGGCGACGGCAAGCGCGTCAAGTACCTCGAGATCAAGCTCAA
GTACGTGATCATCTCGAGCGTCACGCCGAGCGTGCAGAAGGAAGGCCTGCCGGTCGAGCAGTTCTCGCTGAAGTACGCTG
CGGTGCAGTGGAAGCAGACCAAGCAGAACATCGGCGGCAACCAGGGCGGCAACACCCAGGGCGCCTGGAGCCTCACGAAG
AACGACAAGACCTACGCGGTCTGA