Detailed information of effector


Summary

Effector ID EFF00429 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS17509 experimental (Type i2)
Strain Burkholderia glumae BGR1
Replicon chromosome
Sequence Protein sequence (162 a.a.); Nucleotide sequence (486 bp)
Description In the presence of E. coli as prey, the relative gene expression level of only tssD1 was increased whereas the relative gene expression levels of the tssD2, tssD4, and tssD5 genes showed little difference regardless of the presence of prey
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BGLU_RS23285
Coordinates (Strand) 1418865..1419350 (+)
NCBI ID WP_012733890.1
RefSeq NC_012721
Uniprot ID A0A2J9HNU0_BURGL, C5AHX3_BURGB
KEGG ID bgl:bglu_2g11090
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.5e-38 6..146

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-161 MAIPAYMWLKDDGGADIKGSVTVQGREGSVELVAFNHGVHIPTDGNTGKLTGTRVHKPITLTKETDASTPYLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKIVAVNPVMYDIKNPDYEKHNHLENVELRYETITWSYKDGNIIHKDTWNERS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9832 - -



  Protein sequence: 162 a.a.    .

>EFF00429 NC_012721:1418865-1419350 [Burkholderia glumae BGR1]
MAIPAYMWLKDDGGADIKGSVTVQGREGSVELVAFNHGVHIPTDGNTGKLTGTRVHKPITLTKETDASTPYLYKAVTSGQ
TLKSVEIKWYKIDDAGKEKEYFNTKLDNVKIVAVNPVMYDIKNPDYEKHNHLENVELRYETITWSYKDGNIIHKDTWNER
S*

  Nucleotide sequence: 486 bp    .

>EFF00429 NC_012721:1418865-1419350 [Burkholderia glumae BGR1]
ATGGCAATTCCGGCCTATATGTGGCTCAAGGACGATGGCGGTGCCGACATCAAGGGTTCGGTGACGGTTCAGGGCCGAGA
AGGCAGCGTCGAGCTCGTCGCGTTCAATCACGGCGTGCACATCCCGACCGACGGCAACACGGGCAAGCTCACCGGTACGC
GTGTACACAAGCCGATTACGCTCACGAAGGAAACGGACGCGTCGACGCCATACCTGTACAAGGCCGTGACGAGCGGCCAG
ACGTTGAAGTCGGTCGAAATCAAGTGGTACAAGATCGACGACGCGGGCAAGGAGAAGGAGTACTTCAACACGAAGCTCGA
CAACGTCAAGATCGTGGCCGTCAACCCGGTGATGTACGACATCAAGAACCCGGACTACGAGAAACACAACCACCTCGAAA
ACGTCGAACTGCGCTACGAGACGATCACCTGGTCGTACAAGGACGGCAACATCATCCACAAGGACACCTGGAACGAGCGT
TCCTGA