Detailed information of effector


Summary

Effector ID EFF00353 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00292 experimental (Type i4b)
Strain Burkholderia cenocepacia J2315
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) QU43_RS38250
Coordinates (Strand) 368997..369500 (+)
NCBI ID 206558749
RefSeq NC_011000
Uniprot ID UPI00003010A6
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.1e-37 10..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9447 - -



  Protein sequence: 168 a.a.    .

>EFF00353 NC_011000:368997-369500 [Burkholderia cenocepacia J2315]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGT
TFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTK
NDKTYAV*

  Nucleotide sequence: 504 bp    .

>EFF00353 NC_011000:368997-369500 [Burkholderia cenocepacia J2315]
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAATCCGCGGACAAGGACCATCAGGGCTGGATCGA
ACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGGCGGTCACACGATGACGCGTT
GCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCGCTGCTGTACCAGCACGCTTCGGGCGGTACC
ACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACGGTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAA
ATACGTGATCATCTCGAGCATCGCCCCGAGCGTCCGCGAGGAAGGTCTGCCCCTCGAGACGTTCTCGCTGAAGTACGCAG
CCGTGCAGTGGAAGCAAACCCAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGCCTGACGAAG
AACGACAAGACCTACGCGGTCTAA