Detailed information of effector


Summary

Effector ID EFF00321 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (783 a.a.); Nucleotide sequence (2349 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_RS17880
Coordinates (Strand) 3917120..3919468 (-)
NCBI ID 170025773
RefSeq NC_010465
Uniprot ID UPI00004268F9
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 6.7e-71 25..326
Phage_base_V PF04717.14 4.2e-14 380..449

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-782 MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFFTYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQRIHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAIQSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDVVYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGVLAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNRGNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTGTSLSVTGMSTSVTGVSVGFTLIDTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTGSSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTGSSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVGVDLKTVGMQSKN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9955 - -



  Protein sequence: 783 a.a.    .

>EFF00321 NC_010465:c3919468-3917120 [Yersinia pseudotuberculosis YPIII]
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFFTYVIAGADEG
QRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMED
EGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQRIHSSEIVLRDFDFLNPRNTLQT
HIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAIQSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLIS
CDYSFVQDGPDSASQGRNVACKFKALNDDVVYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTE
DDSSCWIRVVQAWAGKGWGVLAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQH
ASQLTFDDNRGNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTG
TSLSVTGMSTSVTGVSVGFTLIDTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTGSSHSMTGMST
SITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTGSSTSTTGNSVSMTGNSTSTT
GCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVGVDLKTVGMQSKN*

  Nucleotide sequence: 2349 bp    .

>EFF00321 NC_010465:c3919468-3917120 [Yersinia pseudotuberculosis YPIII]
ATGCAATTAATTGAGATAGAGAATGAGGTTTTATCGGGCCAGGATGCTTTTCCTCTCTCCTTCAAGACGCAGGAAAAAGT
GTCAGGGAATCCATCCTACCAACTGGTATTTCAGGTAGCAGAAGCGGACCTCGATCTGGTCAGTTTGCTGGGGGAAATCA
TCAAAGTCAGGATTGAGTTACCTGACTCAGCCGGCTACCGGACCTTTTTTACCTATGTGATCGCCGGTGCTGATGAAGGG
CAACGGCAAGACAAATTTGTTTACAGCCTGGAACTGAGTACCTGGACGTGGTTTTTGATGCAAAACCGCAACTGCCGGAT
ATTTCAGGACCTGAATATTATCGATATTATCGAACAGGTATTTTCCAAATATAACTTTGCGGATTACCGTTTTGATATTG
TCGGTAACTATCGGTTACGCGAGTACTGCGTACAGTTTGCAGAAACCGATTTCGACTTTGTTAATCGTCTGATGGAAGAC
GAAGGCGTTTGGTATTACTTCGAACATAACGAAGATAAGCACACGCTGGTCATGACAGATCAGCAACAATTCCCTGTATT
GGAAGGGCATTATGCAGAACTGAGTTTCCTGCCTGACAGTGAAGAGATGCGCGCCATCCGTGAGGGGATACAGCGTATTC
AACGCTCACAACGCATCCACTCCAGCGAAATTGTCTTACGTGACTTCGATTTCCTTAATCCACGCAATACATTACAAACC
CATATCGAAGAAAGCCGCCAACACCTGCAAGGCGTACCACTGGAATGGTATGACTACGCGGCGGGTTACACCGATCCCCA
GCATGGTGAGAGCATCGCCCGTTTACGCCTTGAAGCTATACAGAGTAATGGGCAGCTCTTGTCTGGTGAAAGTAATGCCA
CAGGATTAGTGCCAGGGCGCTCTTTTGCTCTGGTACAGCACCCTGATAACAACCGTAATCGGGGATTCAAACTGATCAGT
TGTGACTACAGTTTTGTCCAGGATGGGCCGGACAGTGCGAGCCAGGGACGTAATGTCGCCTGTAAGTTTAAGGCATTGAA
TGATGACGTCGTTTATCGTCCACAATGTGTCACGCCACCGCCAAAGGTCCCTGGTGTGCAAAGTGCCACAGTGGTCGGTG
CGCGTGAATCAGAAGTGCATACCGATAAGTTCGCCCGTATTCGCGTTCACTTTCACTGGGATCGTTATAAAACCACCGAA
GATGATAGCTCCTGCTGGATCCGCGTTGTACAGGCGTGGGCCGGTAAAGGCTGGGGCGTCCTGGCGATGCCTCGGGTCGG
GCAAGAAGTGCTGGTCAATTACGTTGACGGCGACCTTGATCGCCCGATGGTGACCGGGATCGTCTACAACGGTGAGAACC
CACCGCCTTACCGTTTACCTGACCACATTAACTACTCCGGTTTTGTCTCACGCTCACTGCGCTTTGGTCAGCCACAACAC
GCCAGCCAGCTTACCTTCGATGATAATCGGGGCAATGAGCGGATCATGCTACATGCTGAGCGCGACTTACAAAGAACGGT
TGAACGTAACAGTGCGACGGCCGTCGGTCAGGATAAATACGACACGGTGGAACGGACGGCCACGGAGTGGATCAACAACC
ATATCTCCTACAAAGACTTCAGTTTCTCGGTGACGGGCATGAGTGTCTCCGCGACGGGCATCAGTGTCTCGACAACGGGA
ACGAGCTTATCTGTCACCGGCATGAGCACCAGCGTCACGGGTGTCAGTGTGGGTTTCACCTTGATAGATACCTCCTTTAC
GGGTGTGAGCACATCGTTTACCGGTGTCGGTACCTCCTTCACCGGGGCCAGCAACTCGCTAACCGGTGTCAGCAACTCGA
TGACTGGGTGTAGTTCCTCGTTTACCGGTACTAGCAATAGCATGACAGGCAGTAGCCATAGCATGACCGGCATGAGCACC
AGCATCACCGGGCATAGCATGAGTCAGACGGGTTCCAGTAGCAGCATCACCGGTGACAGTACCTCCTTTACCGGCAGCAG
CGTCAGCAGTACGGGCAGCAGCGTCAGTACGACCGGTGTCAGTACCAGCACTACGGGGAGTAGCACCTCGACTACCGGTT
GTAGCGTCAGTACTACGGGTAGTAGCACCTCGACTACCGGTAATTCAGTCAGCATGACCGGTAACAGCACCAGTACCACG
GGATGCAGTATTTCCACGACGGGCAGCAGTATTGGGACGGTAGGAAGCAGTATCAGCACCACGGGCAGTAGCGTCAGTAC
CACCGGTAGCAGTATCAGCACCACGGGATTATCCGTCAGTTATACCGGCGCTCAATATTCCGATGTGGGTGTCGATCTGA
AAACCGTTGGCATGCAAAGCAAAAACTGA