Detailed information of effector


Summary

Effector ID EFF00316 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00254 experimental (Type i4b)
Strain Acinetobacter baumannii SDF
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABSDF_RS10645
Coordinates (Strand) 2078484..2078987 (-)
NCBI ID 169633798
RefSeq NC_010400
Uniprot ID UPI00003D954E
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5.4e-40 5..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9825 - -



  Protein sequence: 168 a.a.    .

>EFF00316 NC_010400:c2078987-2078484 [Acinetobacter baumannii SDF]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAG
YTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSN
NTASYAA*

  Nucleotide sequence: 504 bp    .

>EFF00316 NC_010400:c2078987-2078484 [Acinetobacter baumannii SDF]
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACAAAGGTTGGTT
AGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGTAGGCGGCCACACTGCTGAAC
GTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGCCCTAAATTATGGGAAGCTTGTTCAGCTGGT
TATACATTTGATGAAGTACAAATCGACTTCTATCGTGCAAATGGTGATAAACGTATCAAGTACTTACAAATCAAATTGAA
GCACGTTCTAGTTTCTAGTGTAACTCCAACTGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTG
CTGTTGAGTGGACTTATAACCAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAAT
AATACAGCTTCTTACGCAGCGTAA