Detailed information of effector


Summary

Effector ID EFF00205 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00161 experimental (Type i3)
Strain Azoarcus olearius
Replicon chromosome
Sequence Protein sequence (163 a.a.); Nucleotide sequence (489 bp)
Description hcp
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AZO_RS19555
Coordinates (Strand) 4275148..4275636 (+)
NCBI ID 119900186
RefSeq NC_008702
Uniprot ID UPI0000EAF9E9
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 7.6e-41 6..135

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-162 MAVDMFIKIGDIKGESVDKVHADKIDVLAWSWGMSQSGTTHMGSGGGSGKVSVQDISFTKYVDASSHALIMACCNGKHYDEAVLIVRKAGEKPLEYIKVTMKEVIVTSVSTGGSGGEDRLTENVTLNFAEFKYEYTKQAPKGGKDSTMTATWNIAENDGNVG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9671 - -



  Protein sequence: 163 a.a.    .

>EFF00205 NC_008702:4275148-4275636 [Azoarcus olearius]
MAVDMFIKIGDIKGESVDKVHADKIDVLAWSWGMSQSGTTHMGSGGGSGKVSVQDISFTKYVDASSHALIMACCNGKHYD
EAVLIVRKAGEKPLEYIKVTMKEVIVTSVSTGGSGGEDRLTENVTLNFAEFKYEYTKQAPKGGKDSTMTATWNIAENDGN
VG*

  Nucleotide sequence: 489 bp    .

>EFF00205 NC_008702:4275148-4275636 [Azoarcus olearius]
ATGGCAGTTGATATGTTCATCAAGATCGGCGACATCAAGGGTGAGTCGGTCGACAAGGTGCACGCCGACAAGATCGACGT
GCTCGCCTGGAGCTGGGGCATGAGCCAGTCCGGCACCACCCACATGGGCAGCGGCGGCGGCTCCGGCAAGGTCAGCGTGC
AGGACATCTCCTTCACCAAGTACGTGGACGCCTCCAGCCACGCGCTGATCATGGCCTGCTGCAACGGCAAGCACTACGAC
GAAGCCGTGCTGATCGTGCGCAAGGCCGGCGAGAAACCGCTCGAGTACATCAAGGTCACGATGAAGGAAGTCATCGTCAC
CTCCGTCAGCACCGGCGGCAGCGGTGGTGAGGATCGCCTGACCGAGAACGTCACGCTGAACTTCGCCGAGTTCAAGTACG
AGTACACCAAGCAGGCGCCGAAGGGTGGCAAGGACAGCACCATGACCGCGACCTGGAACATCGCCGAAAACGACGGCAAC
GTCGGCTGA