Detailed information of effector


Summary

Effector ID EFF00202 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00157 experimental (Type i1)
Strain Aeromonas hydrophila subsp. hydrophila ATCC 7966
Replicon chromosome
Sequence Protein sequence (682 a.a.); Nucleotide sequence (2046 bp)
Description VgrG
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AHA_RS09310 (VgrG3)
Coordinates (Strand) 2019669..2021714 (+)
NCBI ID 117620092
RefSeq NC_008570
Uniprot ID A0KJD1_AERHH
KEGG ID aha:AHA_1848
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 5.4e-90 29..325
Phage_base_V PF04717.14 1.5e-14 389..456

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-681 MADSTGLQFTVKVGALPESTFVVAEFALEEGLNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQRRVCGVVSDFAQGDSGFRRTRYQLMVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNEHVKREYCVQYRESDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSFKTPAYGLSHKKVGTELEHQRDTYQHFDFPGRYKQDPSGKAFAQHRLDALRNDAVAGQAKSNCAALLPGQTFSLTEHPNDSLNTDWQIVRIQHTGLQPQALEEEGGSGPTVYHNEFGVVKASTTWRARIGSPEAPHKPMVDGPQIAMVVGPEGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGWAGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTKTVLRTETHQGEGFNELRFEDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVDASLHQKLGQSLLVEAGQEVHIKVGDKLVLEAGSEITLKGGGSFVKVDPSGIKLVGPAIKLNAGGSAGSGSGWAGQPPIIPKGVEVVKAPELVELVKAIATEKAMEALLKALEPDSDYQPSA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9894 - -



  Protein sequence: 682 a.a.    .

>EFF00202 NC_008570:2019669-2021714 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MADSTGLQFTVKVGALPESTFVVAEFALEEGLNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQRRVCGVVSDF
AQGDSGFRRTRYQLMVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNEHVKREYCVQYRESDLDFVNR
LAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSFKTPAYGLSH
KKVGTELEHQRDTYQHFDFPGRYKQDPSGKAFAQHRLDALRNDAVAGQAKSNCAALLPGQTFSLTEHPNDSLNTDWQIVR
IQHTGLQPQALEEEGGSGPTVYHNEFGVVKASTTWRARIGSPEAPHKPMVDGPQIAMVVGPEGEEIYCDEHGRVKLQFPW
DRYGSSNDQSSCWVRVSQGWAGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTKTVLRTETH
QGEGFNELRFEDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVD
ASLHQKLGQSLLVEAGQEVHIKVGDKLVLEAGSEITLKGGGSFVKVDPSGIKLVGPAIKLNAGGSAGSGSGWAGQPPIIP
KGVEVVKAPELVELVKAIATEKAMEALLKALEPDSDYQPSA*

  Nucleotide sequence: 2046 bp    .

>EFF00202 NC_008570:2019669-2021714 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCCCTGCCCGAGAGCACTTTCGTGGTGGCCGAGTTTGC
GCTGGAGGAAGGACTCAACCGGCCGTTCAACCTGCGCCTGGAGCTGGCGAGTGCCCAGCCCGACATCGACTTTGGCGCCG
TGCTGGACCAGCCGTGCGAACTGCTGGTGTGGTACAACGGCGAGCTGCAGCGCCGGGTGTGCGGAGTGGTCAGTGACTTC
GCGCAAGGGGACAGCGGTTTTCGCCGCACCCGCTATCAGCTCATGGTGCAGCCGGCGCTGTGGCGGCTCTCTTTGCGCCA
GAACTCCCGCATCTTCCAGGCGCAGAAGCCCGACGAAATCCTCTCAATCTTGTTGCAAGAGCACGGCATCACCGATTACG
CCTTTGCGCTCAAGAACGAGCATGTCAAGCGGGAATACTGTGTTCAGTATCGCGAGTCCGACCTCGATTTCGTGAACCGG
CTCGCCGCCGAAGAGGGGATGTTCTACTTCCACGAGTTTGAAGCGGGCAAGCACCGCATTGTGTTTGCCGATGACGCTGC
CGCCCTGACTGCCGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTCCGGCAGTTCC
ACTATCGGGAGGCGGTACGCCCGTCGGATGTGGAGCTCAAAGACTACAGCTTCAAGACGCCGGCTTACGGCCTCTCCCAC
AAGAAGGTGGGGACGGAGCTCGAGCATCAGCGGGATACCTACCAGCACTTCGATTTTCCGGGCCGCTACAAGCAGGACCC
GAGCGGCAAGGCATTTGCCCAACATCGGCTGGATGCGCTGCGCAATGACGCGGTGGCGGGCCAGGCTAAGTCCAACTGCG
CCGCCTTGCTGCCGGGCCAGACGTTTTCACTCACTGAACACCCCAACGACAGCCTCAACACCGACTGGCAAATCGTGCGC
ATCCAGCACACCGGCTTGCAGCCGCAGGCGCTGGAAGAGGAGGGGGGCAGCGGCCCCACCGTCTACCACAACGAATTTGG
CGTGGTGAAGGCGAGCACCACCTGGCGGGCGCGTATCGGCAGCCCGGAAGCCCCTCACAAGCCGATGGTGGACGGCCCGC
AAATCGCCATGGTGGTGGGCCCCGAAGGGGAAGAGATTTACTGCGACGAACACGGCCGGGTGAAGCTGCAATTCCCGTGG
GACCGCTACGGCAGCTCCAACGACCAAAGCTCCTGCTGGGTGCGAGTCTCGCAAGGCTGGGCGGGCGGTCAGTACGGCAT
GATGGCCATCCCGCGCATCGGCCACGAGGTCATTGTGTCATTCCTGGAGGGGGACCCCGACCAGCCCATCGTGACTGGGC
GCACCTATCACGCCACCAACCGGCCTCCTTATGAGCTACCTGCCAACAAGACCAAGACCGTGCTGCGCACCGAAACCCAT
CAGGGGGAAGGTTTTAACGAGCTGCGCTTTGAAGACCAGGCGGGGCAGGAAGAGATCTACATCCACGGTCAGAAAGACCT
GAACGTGCTTATCGAAAATGATGCGGCGTGGCATATCAAGCACGACCAGCACACCGATATCGACAACGAGCGGGTGACCC
GCATCAAGGCCAACGACCACCTGACGGTGGAGGGCGAGAAGCGCGACCAGATAAAAGCCGACTACTCACTGACGGTGGAT
GCCAGCCTGCATCAGAAGCTGGGGCAGTCCCTGCTGGTGGAAGCCGGGCAGGAAGTGCATATCAAGGTGGGCGACAAGCT
GGTGCTGGAGGCGGGTTCTGAAATAACCCTCAAGGGAGGCGGCAGCTTTGTGAAAGTGGATCCTAGCGGCATCAAGCTGG
TGGGCCCCGCCATCAAACTCAATGCTGGCGGCAGCGCAGGTTCAGGCTCTGGCTGGGCAGGTCAGCCTCCCATCATCCCC
AAAGGCGTGGAAGTGGTGAAAGCCCCTGAACTGGTTGAACTGGTCAAGGCTATTGCCACCGAGAAGGCGATGGAAGCGTT
GCTCAAGGCGCTGGAGCCCGATAGCGATTATCAGCCCTCCGCTTGA