Detailed information of effector


Summary

Effector ID EFF00201 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00157 experimental (Type i1)
Strain Aeromonas hydrophila subsp. hydrophila ATCC 7966
Replicon chromosome
Sequence Protein sequence (744 a.a.); Nucleotide sequence (2232 bp)
Description VgrG
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AHA_RS09205 (VgrG2)
Coordinates (Strand) 1991311..1993542 (+)
NCBI ID 117621074
RefSeq NC_008570
Uniprot ID VGRG1_AERHH
KEGG ID aha:AHA_1827
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 3e-90 30..327
Phage_base_V PF04717.14 1.7e-14 389..456

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-743 MADSTGLQFTVKVGALPESTFVVAEFALDEALNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQRRVCGVVSDFAQGDSGFRRTRYQLMVQPALWRLSLRQNCRIFQAQKPDEILSILLQEHGITDYAFALKNEHAKREYCVQYRETDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSCKTPAYGLSHKKQGSELEHQRDTYQHFDYPGRYKQDPSGKAFAQHRLDALRNDAVAGQVKSNCAALLPGQTFSLTEHPNGSLNTDWQIVRIRHTGEQPQALEEEGGSGPTVYHNEFGVVKASTTWRARIGSPEAPHKPMVDGPQIAMVVGPDGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGWAGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTRTVLRTETHQGEGFNELRFEDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRVRKVPGEEGAPPSLGNDHLTVEGEKRDHIKADYSLTVDTSMHQKLGQSWLTQAGQEVHVKAGAKVVLEAGSEITVKVGGCFIKVDGGGVTLVGPTIKMNSGGNAGSGSGWAGKVPKSMEGMLDSPHTRWMKFYHLDSELMPLAGTPYKAVLSDGSVREGTLDGEGMALLEDVPAGTASVTYDLQDTFADLPRESISALTGHLDSLSDEG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9890 - -



  Protein sequence: 744 a.a.    .

>EFF00201 NC_008570:1991311-1993542 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MADSTGLQFTVKVGALPESTFVVAEFALDEALNRPFNLRLELASAQPDIDFGAVLDQPCELLVWYNGELQRRVCGVVSDF
AQGDSGFRRTRYQLMVQPALWRLSLRQNCRIFQAQKPDEILSILLQEHGITDYAFALKNEHAKREYCVQYRETDLDFVNR
LAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSCKTPAYGLSH
KKQGSELEHQRDTYQHFDYPGRYKQDPSGKAFAQHRLDALRNDAVAGQVKSNCAALLPGQTFSLTEHPNGSLNTDWQIVR
IRHTGEQPQALEEEGGSGPTVYHNEFGVVKASTTWRARIGSPEAPHKPMVDGPQIAMVVGPDGEEIYCDEHGRVKLQFPW
DRYGSSNDQSSCWVRVSQGWAGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTRTVLRTETH
QGEGFNELRFEDQAGQEEIYIHGQKDLNVLIENDAAWHIKHDQHTDIDNERVTRVRKVPGEEGAPPSLGNDHLTVEGEKR
DHIKADYSLTVDTSMHQKLGQSWLTQAGQEVHVKAGAKVVLEAGSEITVKVGGCFIKVDGGGVTLVGPTIKMNSGGNAGS
GSGWAGKVPKSMEGMLDSPHTRWMKFYHLDSELMPLAGTPYKAVLSDGSVREGTLDGEGMALLEDVPAGTASVTYDLQDT
FADLPRESISALTGHLDSLSDEG*

  Nucleotide sequence: 2232 bp    .

>EFF00201 NC_008570:1991311-1993542 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCTCTGCCCGAGAGCACCTTCGTGGTGGCCGAGTTTGC
GCTGGATGAAGCGCTCAACCGCCCGTTCAACCTGCGTCTGGAGCTGGCGAGTGCCCAGCCCGACATCGACTTTGGCGCCG
TGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACAACGGCGAGCTGCAGCGCCGGGTCTGCGGGGTGGTGAGTGACTTC
GCGCAGGGTGACAGCGGCTTTCGCCGCACCCGCTATCAGCTCATGGTGCAGCCGGCCCTGTGGCGACTCTCTTTGCGCCA
AAACTGCCGCATCTTCCAGGCGCAAAAGCCCGATGAAATCCTCTCCATCCTGTTGCAAGAGCACGGCATCACCGACTATG
CCTTTGCGCTCAAGAACGAGCATGCCAAGCGGGAGTACTGCGTTCAGTACCGGGAAACCGACCTCGATTTCGTGAACCGG
CTTGCCGCCGAAGAGGGGATGTTCTACTTCCACGAGTTTGAAGCGGGCAAGCACCGCATCGTGTTTGCCGACGACGCGGC
CGCTCTGACTGCCGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTGCGGCAGTTCC
ACTACCGTGAGGCAGTGCGCCCGTCGGATGTGGAGCTCAAAGACTACAGCTGCAAGACGCCTGCCTACGGCCTCTCTCAC
AAAAAGCAGGGCAGTGAGCTCGAGCACCAGCGCGACACCTACCAGCACTTCGACTATCCGGGCCGCTACAAGCAGGACCC
GAGCGGCAAGGCGTTTGCCCAGCATAGGCTGGATGCGCTGCGCAACGACGCGGTGGCGGGCCAGGTTAAGTCCAACTGCG
CCGCGTTGCTGCCGGGCCAGACGTTTTCACTCACTGAACATCCCAACGGCAGCCTCAACACCGACTGGCAAATCGTGCGT
ATCCGTCACACCGGTGAACAACCCCAGGCCTTGGAAGAAGAAGGCGGCAGCGGCCCCACCGTCTATCACAACGAATTTGG
TGTAGTGAAGGCCAGCACCACCTGGCGGGCGCGCATCGGCAGTCCGGAGGCCCCTCACAAGCCCATGGTGGATGGCCCGC
AAATCGCCATGGTGGTGGGCCCCGACGGGGAAGAGATTTACTGCGACGAGCACGGCCGGGTGAAGCTGCAATTCCCGTGG
GACCGCTACGGCTCGAGCAACGACCAGAGCTCCTGCTGGGTGCGAGTCTCGCAAGGCTGGGCCGGCGGCCAATACGGCAT
GATGGCCATCCCGCGCATCGGCCACGAGGTCATCGTGAGCTTTTTGGAAGGGGATCCGGACCAGCCCATCGTGACCGGGC
GCACCTATCACGCCACCAATCGGCCACCGTACGAGCTGCCAGCCAACAAGACCCGCACCGTGCTGCGCACCGAAACCCAC
CAGGGTGAGGGCTTCAACGAGCTGCGCTTTGAAGACCAGGCTGGGCAGGAAGAGATTTACATCCACGGTCAGAAAGACCT
GAACGTGCTGATAGAGAACGATGCCGCTTGGCACATCAAACATGACCAGCACACCGACATCGACAACGAGCGGGTGACCC
GTGTCAGGAAGGTGCCGGGTGAGGAAGGGGCCCCACCCAGTCTTGGCAACGATCATCTGACCGTTGAAGGAGAGAAGCGG
GACCATATCAAGGCTGACTACTCGCTGACCGTGGATACCTCCATGCATCAAAAACTCGGTCAGAGCTGGCTCACCCAGGC
GGGGCAGGAAGTGCACGTCAAAGCCGGTGCCAAGGTGGTGCTGGAAGCGGGTTCTGAAATTACCGTCAAGGTCGGTGGCT
GCTTTATCAAGGTTGATGGCGGCGGTGTCACCCTGGTCGGCCCCACCATCAAGATGAATTCGGGTGGCAATGCAGGCTCT
GGATCTGGTTGGGCTGGCAAGGTACCCAAGAGCATGGAGGGTATGCTGGACAGCCCTCACACACGCTGGATGAAATTTTA
TCACCTCGACTCCGAGCTGATGCCGCTGGCGGGCACCCCCTACAAGGCCGTATTGAGCGATGGTTCGGTGCGGGAAGGCA
CGCTGGATGGTGAGGGCATGGCGCTGCTCGAGGATGTGCCTGCTGGCACCGCCTCAGTGACCTATGACCTGCAGGACACT
TTTGCCGATCTGCCCCGTGAATCCATCTCGGCCCTCACCGGCCATCTCGACAGTCTGAGCGACGAGGGCTGA