Detailed information of effector


Summary

Effector ID EFF00200 experimental
Effector type Tre
Cognate immunity protein -
Related T6SS (Type) T6SS00157 experimental (Type i1)
Strain Aeromonas hydrophila subsp. hydrophila ATCC 7966
Replicon chromosome
Sequence Protein sequence (928 a.a.); Nucleotide sequence (2784 bp)
Description VgrG1 from A. hydrophila possesses ADPRT activity and expression of the vgrG1 gene in HeLa Tet-Off cells induces a rounded phenotype.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AHA_RS05640 (VgrG1)
Coordinates (Strand) 1212752..1215535 (+)
NCBI ID 117619461
RefSeq NC_008570
Uniprot ID A0KHA9_AERHH
KEGG ID aha:AHA_1119
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1.7e-86 30..325
Phage_base_V PF04717.14 5.1e-14 389..455
ADPrib_exo_Tox PF03496.16 2.2e-12 716..892

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-927 MADSTGLQFTVKVGALPESTFVVAEFALDEGLNRPFNLRLELASAQPDLDFGAVLDQPCELLVWYNGELQRRVCGVVSDFAQGDSGFRRTRYQLLVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNEHAKREYCVQYRETDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSFKTPAYGLSRKKVGVELTHQRDTYQHFDFPGRYKEDPTGKAFAQHRLDALRNDAVAGSGKSNSAALLPGQTFSLTEHPNGSLNTDWQVVHIRHTGLQPQALEEEGGSGPTVYHNEFSVVKASTTWRARIGSPEAPHKPMVDGPQIVTVVGPDGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGWAGGQYGMMAIPRIGHEVIVSFLEGDPDQPIITGRTFHATNRPPYELPANKTRTVLRTETHQGEGFNELRFEDQAGKEEIYIHGQKDLNVLIENDAAWHIKHDEHRDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVDASLHQKLGQSLLMEAGSEVHHKAGMKIVMEAGAELTLKVGGSFVKLDASGVTLSGGSIKMNSGGSPGSGSGWGGKAPIQPGNVEVPTPPPATLPAPAIHKSMESMAPLAKPCPAAPPPVPPPPAGGPPAPPPAPPQLAGGPMMPPPPPPVAATGEGKKSAKKWATVEISKADEALRYYSAQGYTLLNNYLRDRPYKQREAIDTLLSRSYLNDEPTSASEFDQAMKAYVADVEAGLAKLPASPDLDFVYRGLALDKPELAALKDQFTGVGNIIVEPGFMSTSPDKAWVNDTLLRIRLPAGHGGRLLGEAAHFKGEAEMLFPTQTRLRVDRVVSSMSGDFDSLLNTIPTSDNASDNRSRIKRLIEVSVL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9889 - -



  Protein sequence: 928 a.a.    .

>EFF00200 NC_008570:1212752-1215535 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MADSTGLQFTVKVGALPESTFVVAEFALDEGLNRPFNLRLELASAQPDLDFGAVLDQPCELLVWYNGELQRRVCGVVSDF
AQGDSGFRRTRYQLLVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNEHAKREYCVQYRETDLDFVNR
LAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYVRQFHYREAVRPSDVELKDYSFKTPAYGLSR
KKVGVELTHQRDTYQHFDFPGRYKEDPTGKAFAQHRLDALRNDAVAGSGKSNSAALLPGQTFSLTEHPNGSLNTDWQVVH
IRHTGLQPQALEEEGGSGPTVYHNEFSVVKASTTWRARIGSPEAPHKPMVDGPQIVTVVGPDGEEIYCDEHGRVKLQFPW
DRYGSSNDQSSCWVRVSQGWAGGQYGMMAIPRIGHEVIVSFLEGDPDQPIITGRTFHATNRPPYELPANKTRTVLRTETH
QGEGFNELRFEDQAGKEEIYIHGQKDLNVLIENDAAWHIKHDEHRDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVD
ASLHQKLGQSLLMEAGSEVHHKAGMKIVMEAGAELTLKVGGSFVKLDASGVTLSGGSIKMNSGGSPGSGSGWGGKAPIQP
GNVEVPTPPPATLPAPAIHKSMESMAPLAKPCPAAPPPVPPPPAGGPPAPPPAPPQLAGGPMMPPPPPPVAATGEGKKSA
KKWATVEISKADEALRYYSAQGYTLLNNYLRDRPYKQREAIDTLLSRSYLNDEPTSASEFDQAMKAYVADVEAGLAKLPA
SPDLDFVYRGLALDKPELAALKDQFTGVGNIIVEPGFMSTSPDKAWVNDTLLRIRLPAGHGGRLLGEAAHFKGEAEMLFP
TQTRLRVDRVVSSMSGDFDSLLNTIPTSDNASDNRSRIKRLIEVSVL*

  Nucleotide sequence: 2784 bp    .

>EFF00200 NC_008570:1212752-1215535 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCCCTGCCCGAGAGCACCTTCGTGGTGGCCGAGTTTGC
GCTGGATGAAGGGCTTAACCGGCCATTCAACCTGCGCCTTGAGCTGGCAAGTGCTCAGCCCGACCTCGACTTTGGCGCCG
TGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACAACGGCGAGCTGCAGCGCCGGGTGTGTGGGGTGGTGAGTGACTTC
GCGCAAGGGGACAGCGGCTTTCGCCGCACCCGCTATCAGCTGCTGGTGCAGCCGGCCCTGTGGCGACTCTCTTTGCGCCA
GAACTCCCGCATCTTCCAGGCACAAAAGCCCGATGAAATCCTCTCCATCCTGTTGCAAGAGCACGGCATCACCGATTACG
CCTTTGCCCTGAAAAACGAGCACGCCAAGCGGGAATACTGCGTTCAGTATCGCGAAACCGACCTCGATTTCGTGAACCGC
CTCGCCGCGGAAGAGGGGATGTTCTATTTCCACGAGTTTGAAGCGGGCAAACACCGCATTGTGTTTGCCGATGACGCGGC
CGCCCTGACCGCTGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTGCGGCAGTTTC
ACTACCGGGAGGCAGTGCGCCCGTCGGATGTGGAGCTCAAAGACTACAGCTTCAAGACCCCGGCTTATGGCCTTTCCCGC
AAGAAGGTGGGGGTGGAGCTGACTCACCAGCGCGACACCTACCAGCACTTCGATTTCCCGGGCCGCTACAAAGAGGACCC
GACCGGCAAGGCCTTTGCCCAACATCGGCTGGATGCGCTGCGCAATGACGCAGTGGCGGGCAGTGGCAAGTCCAACAGCG
CGGCTCTGCTGCCGGGCCAGACGTTTTCACTCACCGAACACCCCAACGGCAGCCTCAACACCGACTGGCAAGTCGTCCAT
ATCCGCCACACCGGCTTGCAGCCACAGGCGCTGGAAGAGGAGGGGGGAAGTGGCCCCACCGTCTACCACAACGAATTTAG
CGTGGTGAAAGCGAGTACCACCTGGCGGGCGCGTATCGGCAGCCCGGAAGCCCCTCACAAGCCGATGGTGGACGGCCCGC
AGATTGTGACCGTGGTGGGCCCCGACGGGGAGGAGATTTACTGCGACGAGCACGGCCGGGTCAAGCTGCAATTCCCGTGG
GACAGATATGGTAGTTCCAACGACCAGAGTTCCTGCTGGGTGCGAGTCTCCCAAGGATGGGCCGGCGGCCAGTACGGCAT
GATGGCCATCCCGCGCATCGGCCACGAGGTCATCGTGAGCTTTCTGGAAGGGGACCCCGACCAGCCCATCATAACGGGGC
GAACCTTCCACGCCACCAACCGGCCACCCTACGAGTTGCCGGCCAACAAGACCCGCACCGTGCTGCGCACCGAAACCCAC
CAGGGTGAAGGCTTCAACGAACTGCGCTTTGAAGACCAGGCGGGCAAGGAAGAGATTTATATCCACGGTCAGAAAGACCT
GAACGTGCTTATCGAAAATGATGCCGCCTGGCACATCAAACACGACGAGCATCGGGATATCGACAACGAGCGGGTGACCC
GCATCAAGGCCAACGATCACCTGACGGTGGAGGGCGAGAAGCGCGACCAGATAAAAGCCGACTACTCGCTGACGGTGGAT
GCGTCCCTTCACCAGAAGTTGGGGCAATCACTGCTGATGGAGGCGGGGAGCGAGGTGCACCACAAGGCGGGTATGAAGAT
CGTGATGGAGGCCGGCGCCGAGTTGACGCTCAAGGTGGGTGGCAGCTTTGTTAAGCTGGATGCCAGTGGCGTCACGCTAA
GCGGTGGCTCCATCAAGATGAATTCTGGCGGCAGCCCGGGTTCTGGCTCTGGTTGGGGTGGTAAAGCCCCCATCCAGCCA
GGCAATGTCGAGGTGCCAACACCACCACCAGCAACATTGCCAGCCCCGGCCATTCACAAGAGCATGGAGTCCATGGCACC
GCTGGCAAAGCCTTGTCCAGCAGCTCCACCACCTGTACCACCTCCGCCTGCCGGGGGCCCACCAGCTCCACCGCCCGCCC
CACCCCAGCTTGCCGGAGGCCCAATGATGCCACCGCCGCCGCCACCTGTTGCAGCCACAGGGGAAGGCAAAAAGTCGGCA
AAGAAGTGGGCGACGGTAGAGATATCCAAAGCGGATGAAGCACTTAGATACTATTCGGCGCAAGGGTACACATTGCTCAA
TAACTATTTGCGTGATCGCCCCTACAAGCAGCGAGAGGCCATCGATACCCTGCTTAGTCGCAGCTATTTGAATGATGAGC
CGACATCTGCGAGTGAGTTTGACCAGGCAATGAAGGCCTATGTTGCCGATGTGGAGGCTGGTCTGGCGAAATTGCCGGCT
TCACCCGATTTGGACTTCGTGTACCGGGGGTTGGCGCTGGACAAGCCGGAGCTTGCAGCCCTGAAAGATCAGTTCACCGG
GGTGGGCAATATCATTGTTGAGCCAGGATTCATGAGTACCTCACCGGACAAGGCCTGGGTCAACGATACCTTGTTGAGGA
TCCGCCTGCCTGCCGGCCATGGTGGCCGTCTGCTGGGGGAGGCTGCGCACTTCAAGGGGGAAGCAGAAATGCTGTTTCCG
ACCCAGACCAGACTCAGGGTCGATCGAGTGGTTTCCTCCATGAGCGGAGATTTTGACTCCTTGCTCAATACGATTCCAAC
TTCTGACAATGCATCGGATAACCGCAGCAGGATCAAGCGACTGATTGAGGTTTCCGTATTATGA