Detailed information of effector


Summary

Effector ID EFF00186 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00152 experimental (Type i1)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description Hcp protein
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA14_03240 (hcp2)
Coordinates (Strand) 288454..288972 (-)
NCBI ID 116053976
RefSeq NC_008463
Uniprot ID UPI00000C6079
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 6.5e-39 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9168 - -



  Protein sequence: 173 a.a.    .

>EFF00186 NC_008463:c288972-288454 [Pseudomonas aeruginosa UCBPP-PA14]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPL
LLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGT
SGSDDWRSPVAG*

  Nucleotide sequence: 519 bp    .

>EFF00186 NC_008463:c288972-288454 [Pseudomonas aeruginosa UCBPP-PA14]
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCGAGGACTCGGT
CGGCAACACCTATCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGAAGTGATCATCCCGCGTGACC
CGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCTGTGGTCATCACCAAGGTCTTCGACAAGGCCTCGCCGCTG
CTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGGTCGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCA
GGAGCACTACTACACCACCGTCCTGGAAGACGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGG
GCAACGCCCACTTCACCCACCTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACC
TCCGGCTCCGACGACTGGCGCTCCCCGGTGGCAGGGTGA