Detailed information of effector


Summary

Effector ID EFF00183 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00150 experimental (Type i3)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (163 a.a.); Nucleotide sequence (489 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA14_01030 (hcp1)
Coordinates (Strand) 101003..101491 (+)
NCBI ID 489174134
RefSeq NC_008463
Uniprot ID V6A7H8_PSEAI, A0A1C7C037_PSEAI, A0A0H2ZJ24_PSEAB, HCP1_PSEAE
KEGG ID pae:PA0085, pau:PA14_01030
PDB ID 4KSR, 1Y12, 6AP1, 4KSS

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.8e-43 6..136

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-162 MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9577 - -



  Protein sequence: 163 a.a.    .

>EFF00183 NC_008463:101003-101491 [Pseudomonas aeruginosa UCBPP-PA14]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYP
QAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNV
QA*

  Nucleotide sequence: 489 bp    .

>EFF00183 NC_008463:101003-101491 [Pseudomonas aeruginosa UCBPP-PA14]
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGGAAATCGACGT
GCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGGCGCCGGCAAGGTCAACGTGC
AGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATGATGGCCTGCTCCAGCGGCAAGCACTATCCG
CAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACCAGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGT
GTCCTCGGTGAGCACCGGCGGCAGCGGTGGCGAGGATCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGG
TCGACTACCAGCCGCAGAAGGCGGATGGCGCGAAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTG
CAGGCCTGA