Detailed information of effector


Summary

Effector ID EFF00144 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (1112 a.a.); Nucleotide sequence (3336 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS25975
Coordinates (Strand) 3085793..3089128 (-)
NCBI ID 83720129
RefSeq NC_007651
Uniprot ID UPI00006681BF
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 7.3e-56 35..340
DUF2345 PF10106.11 3.8e-46 672..820
T6SS_Vgr PF13296.8 3.1e-31 517..623
Phage_base_V PF04717.14 3e-10 445..488

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1111 MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLATGAGERSWNGYVTHAAYADSDGEITRYRITMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPEARRRYELTEPLRNFSLRGQYRETDDAFVLRQLAEAGLSFRIEHAQDAGKEASGDHTVAVFDRRAEFPRGSTIAYNLQDVGDPDGVITQFSERHQMVPDRVVATSWKADELLALAGHAQQQPDDKAPVLPVREIYDGQRAGRFDTIDDAQRFAEQRLDALRLPKRVHYGAGSSRTLEIGKVHTLAGYLDGAITFVPLSIEHEAVNNLGADIGALLGRGELDKGLYRNRFVAVPEGTPIVPLHRDRPIVHGVQTAIVVGEPGSRVSSTRDHQVRVQFPWMRGAAPLPGGLTDTASRSNPAGHAPGDHRSGVLVRVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDMPVVLGQVYGGRVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGSTRGAYRGEGFELATQGWGVVRAGEGVLVSSTARRLATSTQMDVAESVGQLKQAVRTAQGMSESAAAAHAGGLAANAAQADFLKAIDPAQDGKYTGAVNGQSATKSSGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAVSYAAQHVHLTAQRDAHVAAAATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSAMEILADQSVRITSTDDRIDVLAKDAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPVPAPLALFDEQIRFVNENGEPLGNVAYKLKLADGSTVSGVTDDNGRTERVSTDGPTAIQSATLTPTQVVDCCGRTSDVPPPAVKVDIKGIGTNDTLVGSSEKSVTVKGESRPLTEGEIEMAKTVFQDSIDYSAVRVHKGSYFWFNLQSKHTAVTPNNTMYFREEDFVEDFSIVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRGESAYRYEIEPGQVFSDFNMEQQGNLVSDYFALIVVDNRAELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9914 - -



  Protein sequence: 1112 a.a.    .

>EFF00144 NC_007651:c3089128-3085793 [Burkholderia thailandensis E264]
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLATGAGERSWNG
YVTHAAYADSDGEITRYRITMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPEARRRYELTEPLRNFSLRGQYRETDD
AFVLRQLAEAGLSFRIEHAQDAGKEASGDHTVAVFDRRAEFPRGSTIAYNLQDVGDPDGVITQFSERHQMVPDRVVATSW
KADELLALAGHAQQQPDDKAPVLPVREIYDGQRAGRFDTIDDAQRFAEQRLDALRLPKRVHYGAGSSRTLEIGKVHTLAG
YLDGAITFVPLSIEHEAVNNLGADIGALLGRGELDKGLYRNRFVAVPEGTPIVPLHRDRPIVHGVQTAIVVGEPGSRVSS
TRDHQVRVQFPWMRGAAPLPGGLTDTASRSNPAGHAPGDHRSGVLVRVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDM
PVVLGQVYGGRVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGST
RGAYRGEGFELATQGWGVVRAGEGVLVSSTARRLATSTQMDVAESVGQLKQAVRTAQGMSESAAAAHAGGLAANAAQADF
LKAIDPAQDGKYTGAVNGQSATKSSGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAVSYAAQHVHLTAQRDAHVAAA
ATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSAMEILADQSVRITSTDDRIDVLAKDAIVLQQGPNRITLKGGDIT
VETPGQFLVKSGAHPFPGPAAQSVSLPPLPVPAPLALFDEQIRFVNENGEPLGNVAYKLKLADGSTVSGVTDDNGRTERV
STDGPTAIQSATLTPTQVVDCCGRTSDVPPPAVKVDIKGIGTNDTLVGSSEKSVTVKGESRPLTEGEIEMAKTVFQDSID
YSAVRVHKGSYFWFNLQSKHTAVTPNNTMYFREEDFVEDFSIVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRG
ESAYRYEIEPGQVFSDFNMEQQGNLVSDYFALIVVDNRAELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK*

  Nucleotide sequence: 3336 bp    .

>EFF00144 NC_007651:c3089128-3085793 [Burkholderia thailandensis E264]
ATGGATTTAGTCGCCGCATTGACGGGCTATTCTCAAACCACCCGCCACATCCGGATCGACACTGCGATGCCGGGCGCGTT
CGTGGTCGAACGTTTCCATGGGCGCGAGGGCGTCAACGAATCGTTCCGCTTCGAGATCGACGTGCTGTCGAGCGAGCCGT
TTCTCGATCTGACGCCGCTCATCGGCCACGCGGCGCGGCTGCGTCTCGCGACGGGGGCGGGCGAACGGAGCTGGAACGGC
TACGTGACGCACGCGGCCTACGCGGACAGCGACGGCGAGATCACTCGCTATCGCATCACGATGGAGTCGTGGCTCGCGCT
GCTGCGCCTGCGCCGCAATTGCCTGTATTTCGTCGACGTCGACACGAAGGACATCTGCGAGCGTGTGTTCGGCGACTATC
CGGAAGCGCGCCGGCGCTACGAGCTGACGGAGCCGTTGCGCAACTTCAGCCTGCGCGGCCAGTACCGGGAGACCGACGAC
GCGTTCGTGTTGCGCCAGCTTGCCGAAGCCGGCCTGTCGTTCAGGATCGAGCATGCGCAGGATGCAGGCAAGGAAGCGTC
GGGCGATCACACGGTCGCCGTGTTCGATCGTCGCGCGGAATTTCCGCGCGGCAGCACGATCGCGTACAACCTGCAGGACG
TCGGCGATCCGGACGGCGTGATCACGCAATTCTCCGAACGCCATCAGATGGTGCCGGACCGGGTCGTCGCGACGAGCTGG
AAGGCGGACGAATTGCTCGCGCTCGCGGGGCACGCGCAGCAGCAGCCTGACGACAAGGCGCCCGTGCTGCCCGTGCGCGA
AATCTACGACGGCCAGCGCGCGGGCCGCTTCGATACGATCGACGACGCGCAGCGCTTCGCCGAGCAGCGGCTCGACGCGC
TGCGCCTGCCGAAGCGGGTCCACTATGGCGCGGGCTCGTCGCGCACGCTCGAGATCGGCAAGGTCCATACGCTCGCCGGT
TATCTGGACGGTGCGATCACGTTCGTGCCGCTGTCAATCGAGCACGAGGCGGTCAACAATCTCGGCGCCGACATCGGCGC
GCTGCTCGGGCGCGGCGAGCTCGACAAGGGGCTGTACCGCAACCGCTTCGTCGCGGTACCCGAGGGCACGCCGATCGTGC
CGTTGCATCGCGATCGGCCGATCGTGCACGGCGTGCAGACCGCGATCGTCGTCGGCGAGCCCGGCAGCCGCGTCAGCAGC
ACGCGCGATCATCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCGCAGCTCCGCTGCCCGGCGGCCTGACCGACACGGC
GAGCCGCTCGAATCCGGCCGGGCACGCGCCGGGCGATCATCGCTCGGGCGTGCTCGTGCGCGTTGCCGAATCGTCGGCCG
GGCCGAATTTCGGGCATGCGTTCACGCCGCGCGTCGGCGCGGAAGTGGTGATCGGCTTCGAGTCGGGCAACATCGACATG
CCCGTCGTGCTCGGCCAGGTCTACGGCGGGCGCGTGCAGCCGCCGTTCGCGGCGGGCGAAGGCAGCGACGCGAACCATCC
GGGCACGCTGACCGGCCTGCAGACACAAACGCTCGATGGCCAGTCCGGCAGCCGCTGGGTGATGGACGACGCTGCGGGAC
AACTGCGGCACGAACTGAGCAACTCGACCGCGAACAGCCGGCTCGCGCAGGGTTATCTGATCGATCAGCAGGGCTCGACG
CGCGGCGCGTATCGCGGCGAAGGCTTCGAGCTTGCGACCCAGGGATGGGGCGTCGTGCGTGCGGGCGAAGGCGTGCTCGT
ATCGAGCACCGCGCGGCGGCTCGCGACGTCGACGCAGATGGATGTCGCGGAAAGCGTCGGACAACTGAAGCAGGCGGTGC
GGACCGCGCAGGGCATGAGCGAATCCGCCGCCGCGGCGCATGCGGGCGGGTTGGCCGCCAATGCCGCGCAGGCGGATTTC
CTGAAGGCGATCGATCCGGCGCAGGACGGCAAGTACACGGGCGCGGTCAACGGGCAGAGCGCGACGAAGTCGAGCGGCGC
CCAGCGTGACGGCGGCGAGCCGGTCGAGCGCTTCGCCGCGCCGGCGGTGCTGATGGAGTCGCCGGAGAACATCGTGTTGA
CGACGCCGCACAGCGCCGTATCGTATGCGGCGCAGCACGTGCATTTGACCGCGCAGCGCGATGCGCACGTGGCGGCCGCC
GCGACGGTCGCGGCCGCGTCAGGCGATGCGGTGAGCCTGTACGCCGCCGCGGGCGGCCTCAGGGCAATCGCGAGCGACGG
GCCGGTGAGCGTCGAGGCGCATACGTCGGCGATGGAGATTCTCGCGGATCAGTCGGTGCGCATCACGTCGACCGACGATC
GCATCGACGTGCTCGCGAAGGACGCAATCGTGCTGCAGCAGGGGCCGAACCGGATCACGCTGAAGGGCGGCGACATCACG
GTCGAGACGCCGGGGCAGTTCCTCGTGAAGTCGGGCGCGCATCCGTTTCCGGGGCCGGCGGCGCAGAGCGTTTCGCTGCC
GCCGCTGCCGGTTCCCGCGCCGCTCGCGCTGTTCGACGAACAGATTCGCTTCGTCAACGAAAACGGCGAGCCGCTCGGCA
ACGTCGCGTACAAGCTGAAGCTTGCCGATGGCTCGACCGTGTCGGGCGTGACCGACGACAACGGGAGAACCGAGCGCGTG
TCGACGGACGGGCCGACGGCGATCCAGTCGGCGACGCTCACGCCGACGCAGGTCGTCGACTGCTGCGGGCGAACGTCGGA
TGTGCCGCCGCCGGCGGTGAAGGTCGACATCAAGGGCATCGGCACCAACGACACGCTGGTGGGCAGCTCGGAGAAATCGG
TCACGGTCAAGGGTGAGAGCCGGCCGCTGACTGAAGGCGAGATCGAGATGGCGAAAACCGTGTTTCAGGACAGCATCGAT
TACAGCGCGGTGCGCGTGCACAAGGGCAGCTATTTCTGGTTCAACTTGCAGAGCAAGCATACGGCCGTGACGCCGAACAA
TACGATGTATTTCCGCGAAGAGGATTTCGTGGAGGACTTTTCGATTGTCAGCGAGGAGTATCCGAGGCGGGGTTGGTTCA
TGCACGAAATGACGCACGTTTGGCAACATCAACGAGGATATGCCGTACGCTGGCATGCGCTCACCGTGACGATTCGCGGC
GAGAGCGCGTATCGGTACGAAATCGAGCCCGGGCAAGTCTTCAGCGACTTCAATATGGAGCAGCAAGGCAATCTTGTATC
AGACTACTTTGCGCTCATTGTCGTGGACAATCGAGCTGAATTGATTCATGCGCAACCAGGAAGCAAGAATCAACTTCGCC
AAGTGCTGGCCCCACTTCTACAGGATCCCAAGGATGCATCGAATCTTCCGAAATAG