Detailed information of effector


Summary

Effector ID EFF00143 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (943 a.a.); Nucleotide sequence (2829 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS25950
Coordinates (Strand) 3081345..3084173 (-)
NCBI ID 83718482
RefSeq NC_007651
Uniprot ID UPI0000667BA4
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1.2e-64 44..355
DUF2345 PF10106.11 9.4e-39 749..909
T6SS_Vgr PF13296.8 1.3e-25 590..690
Phage_base_V PF04717.14 3.2e-08 492..539

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-942 MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDQGGFRFQLTALAENPSLPLAQLIGAPILIEWQAQEGRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQRVDSYNYLNASVVEISEQVFRRYARGAIAPAWRWALADAAKYPKRSLTAQAGESDFDFLERLWAEEGIFYWFEHEGDARASSLGKHTLVLADSNQRFAPDEPELVGFHQTSDDDPQGCIQHFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGEDRDVAGPYAYQTGAIGDRRAQQQLDAQRVAALQSEGRGTRRDLRPGLRFAIAHHPTLGASDAFICLRVEHSARANVDATVRSAIEQRLGAIASIADAAPAPYGPASALNAALGADTHHGGSLMQDDAVYRNRFVALPAEQAYRPLAASGHGARMHPVAVMPGAQTAIAVGAGDPVHTDRDHRIRIQHHAQRGRNAASREDHPHAANAPADRGAGTWTRMLTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGRGNADAQHNAQAGGPSGSTGNAAAWFAGNTHAAVLTGFKTQDMSMSQQGTGGYRQFMLDDTAGQSSARLYTTDRNSGLTLGHMKQTQDNQRQADRGYGAELATDGAGALRGGAGLLISTAPGVSQMDASAPSQVLAQHRQTLQSLAELAQKQGAEPGGAVPEAASGAGATSTGAAAGKPLPAVDGIEQSREAIGATREGGGGDTAGGGSGSAVAWSKPHLVAHGEAGLAAMSAKSHVWVSGTETVLSAGQDVQLTAKGKTSVVANHGVSLYTQGAAGDGRPVAGQGIALHAASGSVSVQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADFKAAAHQLTGPKSAGAQNALGKGASKDCPQTMGDMISSSAAFADL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9659 - -



  Protein sequence: 943 a.a.    .

>EFF00143 NC_007651:c3084173-3081345 [Burkholderia thailandensis E264]
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDQGGFRFQLTALAENPSLPLAQLIGAPILIEWQAQE
GRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQRVDSYNYLNASVVEISEQVFRRYARGAIAPAWRWALADAA
KYPKRSLTAQAGESDFDFLERLWAEEGIFYWFEHEGDARASSLGKHTLVLADSNQRFAPDEPELVGFHQTSDDDPQGCIQ
HFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGEDRDVAGPYAYQTGAIGDRRAQQQLDAQRVAALQSEGRGTR
RDLRPGLRFAIAHHPTLGASDAFICLRVEHSARANVDATVRSAIEQRLGAIASIADAAPAPYGPASALNAALGADTHHGG
SLMQDDAVYRNRFVALPAEQAYRPLAASGHGARMHPVAVMPGAQTAIAVGAGDPVHTDRDHRIRIQHHAQRGRNAASRED
HPHAANAPADRGAGTWTRMLTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGRGNADAQHNAQAGGPSGST
GNAAAWFAGNTHAAVLTGFKTQDMSMSQQGTGGYRQFMLDDTAGQSSARLYTTDRNSGLTLGHMKQTQDNQRQADRGYGA
ELATDGAGALRGGAGLLISTAPGVSQMDASAPSQVLAQHRQTLQSLAELAQKQGAEPGGAVPEAASGAGATSTGAAAGKP
LPAVDGIEQSREAIGATREGGGGDTAGGGSGSAVAWSKPHLVAHGEAGLAAMSAKSHVWVSGTETVLSAGQDVQLTAKGK
TSVVANHGVSLYTQGAAGDGRPVAGQGIALHAASGSVSVQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAY
LKMEGNDIVVGAPGRADFKAAAHQLTGPKSAGAQNALGKGASKDCPQTMGDMISSSAAFADL*

  Nucleotide sequence: 2829 bp    .

>EFF00143 NC_007651:c3084173-3081345 [Burkholderia thailandensis E264]
ATGTCGATCCCAACTGACGTTCTGCAAGCACTCTTCGGCGGCTGGTCGCAACACGACCGCTTTCTCTGGATCACGACGCC
GCTCGGCGCGAACGCGCTCGTCGCGGAAAGCCTGCATGGCTGGGAGGCACTCGATCAGGGGGGCTTTCGTTTTCAGCTCA
CCGCGCTCGCCGAGAATCCGTCGCTGCCGCTCGCGCAGTTGATCGGCGCGCCGATCCTGATCGAATGGCAGGCGCAGGAA
GGGCGCGACGCGCGCCGGCCGTTCCACGGCCACGTGATCGCCGCCGAGCTCGTCGGCTACAACGGCGGCCTCGCACGCGT
GCGGCTCGTCGTCGAGCCGTGGCTCACGCTGCTGCGGCAGCGCGTCGACAGCTACAACTATCTGAACGCGAGCGTCGTCG
AGATCAGCGAACAGGTGTTCCGCCGTTACGCGCGCGGCGCGATCGCGCCCGCATGGCGATGGGCGCTCGCGGATGCGGCG
AAGTACCCGAAGCGCAGCCTGACCGCGCAAGCCGGCGAATCCGATTTCGACTTCCTCGAGCGCCTCTGGGCGGAGGAAGG
CATCTTCTACTGGTTCGAGCACGAAGGCGACGCGCGTGCGTCGAGCCTCGGCAAGCACACGCTCGTGCTCGCCGATTCGA
ATCAGCGCTTCGCGCCCGACGAACCCGAGCTCGTCGGCTTCCATCAGACGAGCGACGACGATCCGCAAGGCTGCATCCAG
CACTTCATGCACGCGCGGCGCTGGCGGATCGGCAGCGTCGCGCGCGCGAGCTGGGATCACCGCAGCCTGTCGACGCGGCC
GACGGGCGCGCGCGCGAACGGCGCGGTCGCGCCGGGCGAGGACCGCGACGTCGCCGGCCCGTACGCATACCAGACTGGCG
CGATCGGAGACCGGCGCGCGCAGCAGCAACTCGATGCGCAGCGCGTGGCCGCGCTGCAGAGCGAAGGCCGCGGCACGCGC
CGCGATCTGCGGCCTGGGCTGCGTTTTGCGATTGCGCATCATCCGACGCTCGGCGCATCGGATGCGTTCATCTGTCTGCG
CGTCGAGCATTCGGCGCGCGCGAACGTCGATGCGACCGTGCGCAGCGCGATCGAACAGCGCCTCGGCGCGATTGCGTCGA
TCGCCGATGCCGCGCCGGCGCCGTATGGTCCCGCGAGCGCGCTGAATGCGGCGCTCGGCGCCGACACGCATCACGGCGGA
TCGCTGATGCAGGACGACGCTGTCTATCGCAATCGCTTCGTCGCGTTGCCCGCCGAGCAGGCGTATCGGCCGCTCGCCGC
GTCCGGCCATGGCGCGCGCATGCACCCGGTCGCCGTGATGCCGGGGGCGCAGACGGCGATCGCCGTGGGCGCGGGCGATC
CCGTTCACACCGACCGGGATCACCGGATTCGGATTCAGCATCACGCGCAGCGCGGCCGGAATGCCGCGAGCCGCGAAGAT
CATCCGCATGCGGCGAATGCGCCGGCGGACCGAGGCGCCGGCACGTGGACGCGCATGCTGACGCCCGTGGGCGGCGACAA
CTGGGGCGGCGTGAGCGTGCCGCGCGTCGGGCAGGAAGTGTGGACTGAATGGCTCGAAGGCCAGCCCGACCGGCCGGTTG
CGGTGGCCGCGCTCTACAACGGCCGGGGCAATGCCGACGCGCAGCACAACGCGCAGGCGGGAGGCCCGAGCGGCAGTACC
GGCAATGCGGCCGCATGGTTTGCCGGCAATACGCACGCGGCGGTGCTCACGGGCTTCAAGACGCAGGACATGAGCATGAG
CCAGCAGGGCACGGGCGGCTATCGGCAATTCATGCTCGACGATACGGCCGGCCAGTCGAGCGCGCGTCTGTACACGACGG
ACCGCAACAGCGGGCTCACGCTCGGGCACATGAAGCAGACGCAGGACAACCAGCGCCAGGCCGATCGCGGCTATGGCGCG
GAACTGGCGACGGATGGCGCCGGCGCACTGCGCGGCGGCGCGGGGCTCTTGATCAGCACGGCGCCCGGCGTGAGTCAGAT
GGATGCGAGCGCGCCGAGCCAGGTGCTCGCGCAGCATCGCCAGACGTTGCAAAGCCTCGCGGAGCTCGCGCAAAAGCAAG
GCGCGGAGCCGGGCGGCGCGGTGCCTGAGGCGGCGAGCGGAGCGGGCGCGACGTCGACGGGGGCGGCGGCGGGCAAGCCT
TTGCCTGCAGTCGACGGCATCGAGCAGAGCCGCGAAGCGATCGGCGCGACGCGAGAAGGAGGGGGCGGCGACACGGCGGG
CGGCGGGAGCGGCAGCGCGGTCGCGTGGAGCAAGCCGCATCTCGTCGCGCACGGCGAGGCGGGGCTGGCCGCGATGTCGG
CGAAGAGCCACGTGTGGGTGTCGGGTACCGAGACGGTGCTGAGCGCCGGACAGGACGTGCAATTGACGGCGAAGGGCAAG
ACGAGCGTCGTCGCGAATCACGGCGTCTCGCTGTATACGCAGGGCGCGGCGGGCGATGGGCGGCCGGTTGCCGGCCAGGG
CATCGCGTTGCACGCGGCGTCCGGTTCGGTGAGCGTGCAGGCGCAGAACGCCGGCAAGCTGAGCGCGAGCGCGCAGAAGG
CGGTGACGCTCGCGAGCGCGCAGGGCAGCGCGTCCGTGCAGGCGCAACAGCGCGTCCTGCTGAGCGCGGCGAAGGCGTAT
CTGAAGATGGAAGGCAACGACATCGTCGTCGGCGCGCCGGGGCGCGCGGATTTCAAGGCGGCGGCGCATCAGTTGACGGG
GCCGAAGAGCGCGGGGGCGCAGAACGCGTTGGGCAAGGGTGCTTCGAAGGATTGTCCGCAGACGATGGGCGACATGATTT
CGTCCAGCGCCGCATTCGCCGATCTATAA