Detailed information of effector


Summary

Effector ID EFF00142 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (1008 a.a.); Nucleotide sequence (3024 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS25940
Coordinates (Strand) 3077299..3080322 (-)
NCBI ID 83720200
RefSeq NC_007651
Uniprot ID UPI0000668202
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1007 MAGSDDRCDVCKLQGLAVYPSRYAVVPKTFDAPALGPFDDKSVTGVALTQSKYGLRQLREGFVYLLYESGPRGPFHWEVYSVAPDGTLWKQLDTASVKRVSAPQACQRKGHSASRVQYLVIEKPHQCGNVWIAFSEWPWSQDTVKRYGGNDANAASLRKKRMQLIEPSKWISAPKPGPYSAPLTEANLQRVIEHAPAVATTAKGEPVGLLSTELPEAVSYGDLGAFRDARLQICTSRYPWTMRNKAAAGAKLSPAAETVKHAEGSTRNAKGAPCVPMMVALWDGIGITHELNGFRNDAQARFLQYCDEQALRINALQWIDQAKLAVEAGARRKATFDHSPATPGSTSWYYPDAVAKQKAAAKTPADQRFWSDYQWMGENGVPPSYARQITQFRAAPSSPAYQDAMARARKYVEAKPRIEQDRAKKIDQDTVTGTEHDWAKYREKLADDTSGKKGASNGNVKRIDVFRILYQRIQDQKQALLAQRTADVANWLDAPLFLAALEDYHEENGFDGIAFEFAIFHAIVGLSAERSGVAALNKLIDRLDPTKPESLVWRMVASNQKKSKEALKLALAKAEANKNVVLETVGEGFNVFAETSEKLKKFAEFYTKMDEMSKQAKQLNAIDQAMHDKGVDKVVVSVGHLVFQRFPYKGADLMGLGNGVSEAIIKSVFMLRVGIKSEEVKDLVLQQAKVEPQLRSKFLGEYQAQRRMGRSSPEAFRMATSAVAKTEGSNVLANRWSKLKVRESVGLVGVIGLIEVIGLIKLINKSDKEGRDWAELGGACFSVAGAAAEVALKPLEAFKFEEGAKNLKIFGGYCGALAAGVGTTLDTLDAIEKWGSGERLVSVLYFMKGMLGFGTTMAFGLTALSSSAPVFERLASNITGRQIRIVILDRIGQGITDAAARKVAIAAGERVATVAAERVGAMVVGRGLLIMASWQIQVAIISLQFVIWYFGNDDLQNSIKDSIFGVGGKYKNTEDLKKQNEAFDKALVAVGFKDDTASDKEEAKSHR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9909 - -



  Protein sequence: 1008 a.a.    .

>EFF00142 NC_007651:c3080322-3077299 [Burkholderia thailandensis E264]
MAGSDDRCDVCKLQGLAVYPSRYAVVPKTFDAPALGPFDDKSVTGVALTQSKYGLRQLREGFVYLLYESGPRGPFHWEVY
SVAPDGTLWKQLDTASVKRVSAPQACQRKGHSASRVQYLVIEKPHQCGNVWIAFSEWPWSQDTVKRYGGNDANAASLRKK
RMQLIEPSKWISAPKPGPYSAPLTEANLQRVIEHAPAVATTAKGEPVGLLSTELPEAVSYGDLGAFRDARLQICTSRYPW
TMRNKAAAGAKLSPAAETVKHAEGSTRNAKGAPCVPMMVALWDGIGITHELNGFRNDAQARFLQYCDEQALRINALQWID
QAKLAVEAGARRKATFDHSPATPGSTSWYYPDAVAKQKAAAKTPADQRFWSDYQWMGENGVPPSYARQITQFRAAPSSPA
YQDAMARARKYVEAKPRIEQDRAKKIDQDTVTGTEHDWAKYREKLADDTSGKKGASNGNVKRIDVFRILYQRIQDQKQAL
LAQRTADVANWLDAPLFLAALEDYHEENGFDGIAFEFAIFHAIVGLSAERSGVAALNKLIDRLDPTKPESLVWRMVASNQ
KKSKEALKLALAKAEANKNVVLETVGEGFNVFAETSEKLKKFAEFYTKMDEMSKQAKQLNAIDQAMHDKGVDKVVVSVGH
LVFQRFPYKGADLMGLGNGVSEAIIKSVFMLRVGIKSEEVKDLVLQQAKVEPQLRSKFLGEYQAQRRMGRSSPEAFRMAT
SAVAKTEGSNVLANRWSKLKVRESVGLVGVIGLIEVIGLIKLINKSDKEGRDWAELGGACFSVAGAAAEVALKPLEAFKF
EEGAKNLKIFGGYCGALAAGVGTTLDTLDAIEKWGSGERLVSVLYFMKGMLGFGTTMAFGLTALSSSAPVFERLASNITG
RQIRIVILDRIGQGITDAAARKVAIAAGERVATVAAERVGAMVVGRGLLIMASWQIQVAIISLQFVIWYFGNDDLQNSIK
DSIFGVGGKYKNTEDLKKQNEAFDKALVAVGFKDDTASDKEEAKSHR*

  Nucleotide sequence: 3024 bp    .

>EFF00142 NC_007651:c3080322-3077299 [Burkholderia thailandensis E264]
ATGGCGGGAAGCGACGATCGTTGCGACGTTTGCAAGCTTCAGGGGCTGGCGGTCTATCCGTCGCGCTACGCGGTGGTGCC
AAAAACCTTCGACGCGCCAGCGCTCGGACCATTCGACGACAAGAGCGTCACGGGCGTGGCGCTCACGCAAAGCAAGTACG
GCTTGCGTCAACTCCGCGAGGGCTTCGTCTATTTGCTCTACGAATCGGGCCCTCGCGGCCCGTTTCATTGGGAAGTGTAT
TCAGTCGCGCCGGACGGCACGCTCTGGAAGCAGCTGGATACGGCGAGCGTGAAGCGGGTGAGCGCTCCACAGGCTTGTCA
GCGAAAGGGGCATAGCGCGTCGCGTGTCCAGTATCTCGTCATCGAGAAACCACATCAGTGCGGCAATGTCTGGATCGCGT
TCAGCGAATGGCCGTGGAGCCAAGACACGGTTAAGCGTTACGGCGGCAACGACGCGAACGCCGCGAGTCTGCGCAAGAAA
CGCATGCAACTGATCGAGCCTTCGAAGTGGATATCGGCGCCGAAGCCGGGGCCGTATTCGGCGCCGCTGACGGAGGCCAA
TCTGCAGCGTGTCATCGAACACGCGCCTGCTGTCGCGACCACGGCGAAAGGCGAACCCGTCGGCTTGCTCAGCACGGAAC
TGCCGGAGGCGGTCAGCTACGGGGACTTGGGCGCGTTTCGCGACGCTCGCCTGCAAATTTGTACGTCGCGCTACCCATGG
ACCATGCGCAACAAGGCTGCGGCGGGTGCAAAGCTGAGCCCGGCCGCGGAAACGGTCAAGCACGCGGAGGGCAGTACCCG
AAACGCAAAGGGTGCGCCGTGCGTGCCGATGATGGTGGCGCTGTGGGACGGCATCGGGATCACGCACGAACTGAACGGCT
TCCGCAACGATGCGCAGGCGCGCTTTCTGCAGTATTGCGACGAGCAGGCGCTCCGAATCAACGCGCTGCAATGGATCGAT
CAGGCGAAGCTCGCGGTGGAAGCCGGTGCGCGCAGAAAGGCGACGTTCGATCATAGCCCGGCCACGCCGGGCAGCACGAG
CTGGTATTACCCGGATGCCGTCGCGAAGCAAAAGGCGGCGGCGAAGACTCCGGCGGATCAGCGGTTCTGGAGCGACTATC
AGTGGATGGGGGAAAACGGCGTACCGCCGTCATACGCCAGACAGATCACGCAGTTTCGCGCGGCGCCGTCTTCGCCGGCC
TATCAGGATGCGATGGCGAGAGCGCGCAAGTATGTCGAGGCCAAGCCGAGAATCGAGCAGGATCGCGCGAAAAAGATCGA
CCAGGACACCGTTACCGGAACCGAGCACGATTGGGCGAAGTATCGCGAGAAATTGGCGGACGATACGTCGGGCAAGAAGG
GGGCGTCCAACGGGAACGTCAAACGTATCGACGTCTTTCGCATCCTGTACCAGCGTATCCAGGACCAGAAGCAAGCGTTG
CTCGCGCAGCGGACGGCGGATGTCGCGAACTGGCTGGATGCGCCGCTTTTCCTGGCGGCGCTGGAGGATTATCACGAAGA
GAACGGCTTCGACGGGATTGCGTTCGAGTTTGCCATTTTCCATGCGATCGTCGGATTGAGCGCCGAGCGAAGCGGCGTGG
CCGCATTGAACAAGCTGATCGATCGCCTGGATCCGACGAAGCCGGAGAGCCTCGTTTGGCGAATGGTGGCGAGCAACCAG
AAGAAATCGAAGGAAGCGCTGAAGCTTGCGCTCGCGAAGGCGGAGGCGAACAAGAACGTCGTACTGGAGACGGTCGGCGA
AGGATTCAACGTATTCGCGGAAACGTCCGAAAAGCTGAAGAAGTTCGCCGAGTTTTACACGAAGATGGACGAAATGAGCA
AGCAGGCCAAACAGCTCAACGCCATTGATCAGGCAATGCACGACAAGGGCGTCGACAAGGTGGTCGTCAGTGTCGGGCAT
CTTGTTTTTCAGCGCTTTCCGTACAAGGGGGCCGATTTGATGGGCCTTGGAAACGGCGTGAGCGAGGCGATCATCAAGTC
CGTGTTCATGCTGCGGGTCGGCATCAAGAGCGAAGAGGTGAAGGACCTCGTCTTGCAGCAAGCCAAGGTGGAGCCGCAGC
TTCGGAGCAAGTTCCTCGGAGAGTACCAGGCGCAGCGCCGAATGGGACGCAGTTCGCCGGAAGCCTTCCGGATGGCCACG
TCGGCTGTTGCCAAGACCGAAGGCTCGAACGTGCTGGCCAATCGCTGGAGCAAGCTCAAGGTGCGCGAGAGTGTCGGCCT
TGTGGGCGTGATCGGGCTGATCGAAGTGATCGGGTTGATCAAGCTGATTAACAAGAGCGACAAGGAAGGGCGGGATTGGG
CTGAATTGGGCGGCGCATGTTTTTCGGTGGCGGGCGCTGCGGCGGAGGTTGCGCTCAAACCTCTGGAAGCATTCAAGTTT
GAAGAAGGAGCCAAGAATCTGAAGATTTTTGGTGGGTATTGCGGGGCCCTGGCTGCTGGAGTAGGGACGACTTTGGATAC
CTTGGACGCCATAGAAAAATGGGGAAGCGGTGAAAGACTTGTTAGTGTTCTTTACTTCATGAAGGGCATGCTCGGGTTTG
GCACGACAATGGCGTTTGGCTTGACGGCGTTGAGCTCATCCGCACCGGTTTTTGAACGTCTTGCGTCCAATATCACTGGG
AGGCAGATTCGTATCGTTATTCTCGATCGGATCGGTCAAGGTATCACTGACGCAGCGGCACGTAAGGTCGCGATAGCAGC
CGGAGAGCGAGTCGCAACCGTAGCAGCAGAGCGAGTTGGGGCAATGGTGGTGGGCAGAGGTCTGCTGATTATGGCTAGTT
GGCAAATCCAAGTTGCTATTATTTCGCTTCAATTTGTTATTTGGTACTTTGGAAATGATGATCTTCAGAATTCAATAAAA
GACTCCATTTTTGGGGTTGGCGGGAAATATAAAAATACAGAAGATTTAAAAAAACAGAATGAGGCTTTCGATAAAGCCCT
GGTGGCTGTTGGGTTTAAGGATGACACTGCTTCTGATAAGGAAGAGGCGAAATCGCATAGATGA