Detailed information of effector


Summary

Effector ID EFF00141 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS21555
Coordinates (Strand) 2056900..2057376 (-)
NCBI ID 83721528
RefSeq NC_007651
Uniprot ID UPI00006686EF
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MSMACTGTAFYQAFKQNMEALGLDVPSSWYGTQTALLTRVGALVAAVDRLGKDATLAELIGATTLPEKLLAAGGIYASWYVGAAVGSLMVATGKFTQCSSSTDISRAVQRFQFEAAIRVPSSLLFHLQTHPEIFDDNATNRLMYARRGLSTKQPEFAK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9773 - -



  Protein sequence: 159 a.a.    .

>EFF00141 NC_007651:c2057376-2056900 [Burkholderia thailandensis E264]
MSMACTGTAFYQAFKQNMEALGLDVPSSWYGTQTALLTRVGALVAAVDRLGKDATLAELIGATTLPEKLLAAGGIYASWY
VGAAVGSLMVATGKFTQCSSSTDISRAVQRFQFEAAIRVPSSLLFHLQTHPEIFDDNATNRLMYARRGLSTKQPEFAK*

  Nucleotide sequence: 477 bp    .

>EFF00141 NC_007651:c2057376-2056900 [Burkholderia thailandensis E264]
ATGTCTATGGCCTGCACGGGAACAGCGTTCTACCAAGCCTTCAAGCAAAACATGGAAGCGCTAGGGCTCGATGTGCCGTC
GAGCTGGTACGGCACCCAAACCGCCCTGCTTACACGCGTCGGCGCACTCGTCGCAGCTGTCGACCGGCTCGGCAAGGATG
CAACGCTTGCGGAACTGATCGGCGCAACGACTTTGCCTGAGAAACTGCTAGCGGCCGGCGGAATCTATGCATCGTGGTAT
GTCGGCGCGGCCGTCGGTAGCCTCATGGTCGCCACCGGCAAATTTACGCAGTGCAGCAGCTCGACTGACATCTCACGAGC
CGTCCAACGATTCCAGTTCGAGGCGGCGATCCGTGTTCCGAGCAGCCTGCTGTTTCACCTGCAGACGCACCCGGAAATCT
TCGATGACAACGCAACGAACCGCCTCATGTATGCGCGCCGCGGCCTGTCGACAAAGCAACCCGAATTCGCGAAATGA