Detailed information of effector


Summary

Effector ID EFF00138 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (1013 a.a.); Nucleotide sequence (3039 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS04480
Coordinates (Strand) 1009425..1012463 (-)
NCBI ID 83717090
RefSeq NC_007650
Uniprot ID UPI000066765E
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1.2e-70 58..361
Phage_base_V PF04717.14 1e-06 426..492

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1012 MSSSHRHYADTALADVAALTDAASRADAAPLANARRFTFASTAYDAATFDVVDIDGRDAISQPYRFEITLVSRSVRIDFAKMLSCEATLAILPPFGEAGTTRYAGVLAEFEQKERFRDFTVYRAALVPRLWRLSLYKASDVYLNEQTIPDIVKRVLRAASFGKRNFRMRHRGVYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRREKLEIVDDRRDQPGPADDLALRYLPATCLDAGIESDRVQAFACRATPLPREVVLRDFNHRKAELSLEVREHVAHDGVGERVSSDEHFHTKDEGRRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYRKDFDGRYLVTAVTHRGSQAHLLFPDLDAPFGATPGEPVYRAEFEAIAANLQYRPPRTTPKPRAAGVVSAIVDGEGSGKRAELDEHGQYKVRFPFAHTAHPTNKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVTRSNPDAHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLKCSVSMGGNTDIYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANAGAAATAAGLIKGGGALADLPWAGFGVSAAQFAGATGFSTALMATSRTLLSKIAKLQEALPLVADLSLDKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAAEHAHVHANDTLLFAVPADPTSKFDLKELIGLRRDLDECVKGIADLEADISENEVLSTDQNTFGVGALVPTPPSPANAVAAVAIKAKEAKLVELNAKRKLVATKIDNLQQKLAKHAKNLSAARMSASDAEVGFKGNRLVATAEGVTLAHAQGKAKLDVREAKIGVEAGKSSLELDESKLAAGCGGASLKLGSDGAIDVRATNVKLNGSASLKLDGQLIQLG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8709 - -



  Protein sequence: 1013 a.a.    .

>EFF00138 NC_007650:c1012463-1009425 [Burkholderia thailandensis E264]
MSSSHRHYADTALADVAALTDAASRADAAPLANARRFTFASTAYDAATFDVVDIDGRDAISQPYRFEITLVSRSVRIDFA
KMLSCEATLAILPPFGEAGTTRYAGVLAEFEQKERFRDFTVYRAALVPRLWRLSLYKASDVYLNEQTIPDIVKRVLRAAS
FGKRNFRMRHRGVYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRREKLEIVDDRRDQPGPADDLALRYLPATCLD
AGIESDRVQAFACRATPLPREVVLRDFNHRKAELSLEVREHVAHDGVGERVSSDEHFHTKDEGRRYAKLRAEALVCEGRR
FAGESTAAGLRAGRFFALSGHYRKDFDGRYLVTAVTHRGSQAHLLFPDLDAPFGATPGEPVYRAEFEAIAANLQYRPPRT
TPKPRAAGVVSAIVDGEGSGKRAELDEHGQYKVRFPFAHTAHPTNKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDG
GDPDRPVIVGAVPNSSHRSVVTRSNPDAHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFS
LGNAYSFSGGLKCSVSMGGNTDIYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLS
AGQDASALLQKQLDKLKGTVRKFMIVSGLANAGAAATAAGLIKGGGALADLPWAGFGVSAAQFAGATGFSTALMATSRTL
LSKIAKLQEALPLVADLSLDKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAAEHAHVHAN
DTLLFAVPADPTSKFDLKELIGLRRDLDECVKGIADLEADISENEVLSTDQNTFGVGALVPTPPSPANAVAAVAIKAKEA
KLVELNAKRKLVATKIDNLQQKLAKHAKNLSAARMSASDAEVGFKGNRLVATAEGVTLAHAQGKAKLDVREAKIGVEAGK
SSLELDESKLAAGCGGASLKLGSDGAIDVRATNVKLNGSASLKLDGQLIQLG*

  Nucleotide sequence: 3039 bp    .

>EFF00138 NC_007650:c1012463-1009425 [Burkholderia thailandensis E264]
ATGTCTTCGTCCCATCGACACTACGCCGACACGGCGCTCGCGGATGTCGCGGCGCTCACGGATGCCGCGTCGCGCGCCGA
CGCCGCGCCGCTCGCGAACGCGCGACGCTTCACGTTCGCGAGCACCGCGTACGACGCTGCCACGTTCGACGTCGTCGACA
TCGACGGCCGCGACGCGATCTCGCAGCCGTACCGGTTCGAGATCACGCTCGTGAGCAGGAGTGTGCGGATCGACTTCGCG
AAGATGCTGAGTTGCGAGGCGACGCTCGCGATCCTGCCGCCGTTCGGTGAGGCCGGCACGACCCGCTATGCCGGCGTGCT
CGCCGAATTCGAGCAGAAGGAACGCTTTCGCGACTTCACCGTCTATCGCGCGGCGCTCGTGCCGCGCCTCTGGCGCCTCT
CGCTGTACAAGGCGTCGGACGTCTACCTGAACGAGCAGACGATTCCCGATATCGTCAAGCGCGTGCTGCGCGCCGCGTCG
TTCGGCAAGCGCAATTTCCGCATGCGGCACCGCGGCGTCTACCGCAAGCGCAGCTTCGTCTGCCAGTACGACGAGAGCCA
TCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGGCCTCTACTACTACTTCGAGCATGACGGCCGACGCGAAAAGCTCG
AGATCGTTGACGACCGCCGCGACCAGCCCGGCCCCGCCGACGATCTCGCGCTGCGCTACCTACCCGCCACCTGTCTCGAC
GCGGGCATCGAATCGGACCGCGTGCAGGCGTTCGCATGCCGCGCGACGCCGCTGCCGCGCGAGGTCGTGCTGCGCGATTT
CAACCACCGCAAGGCGGAGCTGTCGCTCGAAGTCCGCGAGCACGTGGCGCACGACGGCGTCGGCGAGCGGGTATCGAGCG
ACGAGCATTTCCACACGAAGGACGAAGGGCGGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTTTGCGAAGGCCGCCGT
TTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCGGGCCGCTTCTTCGCGCTCTCGGGCCACTACCGCAAGGACTTCGA
CGGCCGCTATCTGGTGACGGCGGTCACGCATCGCGGCTCGCAGGCGCACCTGCTGTTTCCCGATCTCGACGCGCCGTTCG
GCGCGACGCCGGGCGAGCCCGTCTACCGCGCCGAGTTCGAGGCGATCGCCGCCAACCTCCAGTACCGGCCGCCGCGCACG
ACGCCGAAGCCGCGCGCGGCGGGCGTCGTCAGCGCGATCGTCGACGGCGAGGGCAGCGGCAAGCGCGCCGAACTCGACGA
ACACGGCCAGTACAAAGTGCGCTTTCCGTTCGCGCACACCGCGCATCCGACGAACAAGGCCTCCGCGCGCATCCGGATGG
CGACGCCCTATGCGGGCGACGACCGCGGCATGCATCTGCCGCTTCTGAAGCGCACCGAAGTGAAGATCGCATTCGACGGC
GGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACGCGCAGCAACCCCGA
CGCGCACCGGATCCTCACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCGCGGCGACGTGGCTGCACGCGCCGA
ACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGCGCTCCTCACGTCCGGCAACAAGTTCGATTTCTCG
CTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAGTGCTCGGTGTCGATGGGCGGCAACACCGACATCTACGTCGGCGT
GCGCAACAGCCTCGACGTCAGCGCGAACTTCCTGACGACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGAA
GCTTCGAGATCAACGACAGCGCGTCCACGCTGCTGCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCC
GCCGGGCAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCGTGTC
GGGCCTCGCGAACGCCGGAGCCGCGGCCACCGCTGCGGGGCTCATCAAGGGCGGCGGCGCGCTCGCCGATCTGCCGTGGG
CGGGCTTCGGCGTGTCCGCCGCGCAGTTCGCCGGCGCGACCGGCTTCAGCACGGCGCTGATGGCGACCTCGCGCACGCTG
CTCTCGAAAATCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCGATCTATCGCTCGACAAGCAAGGCATCGCGCTCGC
GGCGAAGAACCTCACGCACGCGACGCGGATGTCGCTCACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCGG
GCGCGGCAGGCGCCGCGATGAGCGTCGGCAAGGGCCGCTGGGGCGTCGAAGCGGCGGAGCACGCGCATGTCCACGCGAAT
GACACGCTGCTGTTCGCCGTGCCGGCCGACCCAACGAGCAAGTTCGACCTCAAGGAGCTGATCGGGCTGCGCCGCGATCT
CGACGAATGCGTGAAGGGTATCGCCGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTTTCGACCGATCAGAACACGT
TCGGCGTCGGCGCGCTCGTGCCCACGCCGCCGTCGCCCGCCAATGCGGTCGCGGCGGTCGCGATCAAGGCGAAGGAAGCG
AAGCTCGTCGAGCTGAACGCCAAACGCAAGCTCGTCGCGACGAAGATCGACAACCTCCAGCAGAAGCTCGCGAAGCACGC
GAAGAACCTGAGCGCCGCGCGGATGAGCGCGTCGGACGCGGAAGTCGGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCG
AAGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGAAGCTCGACGTGCGCGAGGCGAAGATCGGCGTCGAGGCAGGCAAA
TCGAGCCTCGAGCTCGACGAGAGCAAGCTCGCGGCCGGCTGCGGCGGCGCCTCGCTGAAGCTGGGCAGCGACGGCGCGAT
CGACGTGCGCGCGACTAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGCTCGACGGACAGTTGATCCAGCTAGGCTGA