Detailed information of effector


Summary

Effector ID EFF00137 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (300 a.a.); Nucleotide sequence (900 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS01610
Coordinates (Strand) 379615..380514 (-)
NCBI ID 83716914
RefSeq NC_007650
Uniprot ID UPI00006675B5
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-4 MKKY
Transmembrane helix 5-27 ALALLLMLFSSMSAMAGAIIPSG
Outside 28-299 GTLVAGQYVISNNGNFAFGIDAATGKLYFHYKFPTQAWGASSMSQIYGTKPEGALYVGKGDRLVMQTDGRLVFYAGNDVVWSNWYFGPAPIPGSYAVVEDFGVVAIYPPQGGYPSFTWPFASITPNSGALTTVAGYPFGLNFPVLNGYQSLQVFNNVTHYLWNKSFAADSVAMQPDGNLVVYNKGGPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGIVANVPYPVSVDQSSRASGPDDPKPATPPPPALNLPINASWKCYYVRDWLVCYAPG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9966 pos: 20-21. AMA-GA. MKKYALALLLMLFSSMSAMA



  Protein sequence: 300 a.a.    .

>EFF00137 NC_007650:c380514-379615 [Burkholderia thailandensis E264]
MKKYALALLLMLFSSMSAMAGAIIPSGGTLVAGQYVISNNGNFAFGIDAATGKLYFHYKFPTQAWGASSMSQIYGTKPEG
ALYVGKGDRLVMQTDGRLVFYAGNDVVWSNWYFGPAPIPGSYAVVEDFGVVAIYPPQGGYPSFTWPFASITPNSGALTTV
AGYPFGLNFPVLNGYQSLQVFNNVTHYLWNKSFAADSVAMQPDGNLVVYNKGGPVWSTGTSGNPGAYMLVTPVGFVLGKQ
YGGIVANVPYPVSVDQSSRASGPDDPKPATPPPPALNLPINASWKCYYVRDWLVCYAPG*

  Nucleotide sequence: 900 bp    .

>EFF00137 NC_007650:c380514-379615 [Burkholderia thailandensis E264]
ATGAAGAAATACGCATTGGCGCTCTTGTTGATGCTGTTTTCGTCGATGTCCGCAATGGCGGGGGCGATCATTCCATCGGG
CGGCACGCTGGTGGCGGGACAATACGTGATATCGAACAATGGCAATTTCGCATTCGGCATCGACGCGGCAACCGGCAAGC
TCTATTTCCACTACAAGTTCCCGACGCAGGCGTGGGGCGCAAGTTCGATGTCGCAAATCTACGGAACGAAGCCCGAGGGC
GCGCTCTACGTCGGCAAAGGCGACCGGCTCGTGATGCAGACCGACGGCCGGCTCGTGTTCTACGCGGGCAACGACGTCGT
CTGGAGCAACTGGTATTTCGGCCCCGCGCCGATTCCGGGCTCGTATGCCGTCGTCGAGGATTTCGGCGTCGTCGCGATCT
ATCCGCCGCAGGGCGGCTATCCTTCGTTCACCTGGCCGTTCGCATCGATCACGCCGAACAGCGGCGCGCTCACGACAGTC
GCCGGCTATCCGTTCGGCCTGAACTTCCCGGTGCTCAACGGATACCAATCGCTGCAGGTCTTCAACAACGTCACCCATTA
CCTGTGGAACAAGAGCTTCGCGGCGGACAGCGTCGCGATGCAGCCCGACGGCAATCTCGTCGTGTACAACAAGGGAGGGC
CGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTGTCGGCTTCGTGCTCGGCAAGCAG
TACGGCGGCATCGTCGCGAACGTGCCGTATCCGGTGTCCGTTGACCAGTCGAGCCGCGCGAGCGGCCCGGACGATCCGAA
GCCCGCCACGCCGCCGCCTCCTGCGCTGAACCTGCCGATCAACGCGAGCTGGAAGTGCTATTACGTCAGGGACTGGCTCG
TGTGCTACGCGCCTGGTTGA