Detailed information of effector


Summary

Effector ID EFF00135 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (927 a.a.); Nucleotide sequence (2781 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS00450
Coordinates (Strand) 97680..100460 (+)
NCBI ID 83716745
RefSeq NC_007650
Uniprot ID UPI000066750D
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1.3e-72 46..378
DUF2345 PF10106.11 5e-40 705..849
T6SS_Vgr PF13296.8 6.2e-39 564..671
Phage_base_V PF04717.14 6e-07 494..536

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-926 VTNLNDTLRNFASGAVDWNKRPVALHFGAAQGALGHLLALQHASVQEGLMTGIGGRLTCVSTRRDIPPGVFLGMPVSIRLITDRGQPHMVNAIISDVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGEQPLQGDATVHTLVCCDEPMSLPQAPAGTVRLHPRDAGTEQRDTVTLFALRRQLVPGKAGRPSWDYKKARIDESSVASSLDQGEAGNDLAKLLTDIAIDIPHAGDSWSDHERLTRARMLAHEFEAERYDGVSSVRDLAVGAWITLTGDPDWDRQLADKRQFVITSIDHDIWNNLPKGLNDRVHALFAASRNLVNAPGALPAALANDADTRYENTFTCVRRGVPLAPAYDPQADLPPVHLLTGTIVGAEGEEVFCDENGRVRVRVHGLDPADHAHAQGAGTNDNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGANPPATFSHAGGLPGNRYLSGIKTKEIKGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGAELRTDAAAALRAAQGILLTTYARTQASGGQLDRDELIRLLGECSELFKALGDYAGQHGGQAADTAGQHAVAAAFRNWTPGAGGADAPPDGGDRALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGPMLLQAQADTLTANAQKGVKITTNEHEVFVSAPRIRLVAEDGSYLEIGNGITLGTNGDIKLLSASHQWGGPSTAQAAKTAFDNQPTDQRFKLHYPGEDGDLPAAANKPFRITLNDGRVIEGKTDASGLTDLVKDDAMRIAKIDYLKPKL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6532 - -



  Protein sequence: 927 a.a.    .

>EFF00135 NC_007650:97680-100460 [Burkholderia thailandensis E264]
VTNLNDTLRNFASGAVDWNKRPVALHFGAAQGALGHLLALQHASVQEGLMTGIGGRLTCVSTRRDIPPGVFLGMPVSIRL
ITDRGQPHMVNAIISDVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDL
SGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGEQPLQGDATVHTLVCCDEPMSLPQAPAGTVRLHPR
DAGTEQRDTVTLFALRRQLVPGKAGRPSWDYKKARIDESSVASSLDQGEAGNDLAKLLTDIAIDIPHAGDSWSDHERLTR
ARMLAHEFEAERYDGVSSVRDLAVGAWITLTGDPDWDRQLADKRQFVITSIDHDIWNNLPKGLNDRVHALFAASRNLVNA
PGALPAALANDADTRYENTFTCVRRGVPLAPAYDPQADLPPVHLLTGTIVGAEGEEVFCDENGRVRVRVHGLDPADHAHA
QGAGTNDNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGANPPATFSHAGGLPGNRYLSG
IKTKEIKGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGAELRTDAAAALRAAQGILLTTYAR
TQASGGQLDRDELIRLLGECSELFKALGDYAGQHGGQAADTAGQHAVAAAFRNWTPGAGGADAPPDGGDRALMAFGAQAG
SVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGPMLLQAQADTLTANAQKGVKITT
NEHEVFVSAPRIRLVAEDGSYLEIGNGITLGTNGDIKLLSASHQWGGPSTAQAAKTAFDNQPTDQRFKLHYPGEDGDLPA
AANKPFRITLNDGRVIEGKTDASGLTDLVKDDAMRIAKIDYLKPKL*

  Nucleotide sequence: 2781 bp    .

>EFF00135 NC_007650:97680-100460 [Burkholderia thailandensis E264]
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCGCGTTGCACTT
TGGCGCCGCGCAAGGCGCGCTGGGCCACCTCCTCGCGTTGCAACACGCCAGTGTTCAGGAAGGTCTGATGACCGGGATTG
GCGGGCGATTGACCTGTGTTTCGACCCGTCGCGACATCCCACCCGGCGTGTTTCTCGGCATGCCGGTCTCGATCCGGCTC
ATTACCGATCGCGGACAGCCGCACATGGTGAACGCGATCATCAGCGACGTCCAGATCGGCCAAAGCGACGGCGAGCTCTG
TGTGTACCAGCTGACGGTCTGCGACGCGCTGTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCG
TCATCGATGTGCTCGCCACGCTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCATTCGAATTCGATCTG
TCCGGCTTGCGCGCCGATCGCTATCCGCCCCGCGAACTGACCCGGCAAGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACAGCCGTTGCAGGGCGATGCGA
CCGTGCACACGCTCGTGTGCTGTGACGAGCCGATGTCGCTGCCGCAAGCGCCGGCCGGCACGGTTCGCTTGCATCCGCGC
GACGCCGGCACCGAGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCGGCAATTGGTGCCCGGCAAGGCCGGACGCCC
GTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGCGTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGATC
TGGCGAAGCTGCTGACCGACATCGCGATCGACATTCCGCACGCGGGCGATTCATGGAGCGATCACGAGCGGCTCACCCGC
GCGCGCATGCTCGCGCACGAGTTCGAGGCCGAGCGCTACGACGGCGTTAGCAGCGTGCGGGATCTGGCCGTGGGCGCGTG
GATCACGCTGACGGGCGATCCGGACTGGGACAGGCAACTCGCCGACAAGCGCCAGTTCGTGATCACGTCGATCGATCATG
ACATCTGGAACAACCTGCCGAAGGGGCTCAATGACCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCTCGTGAACGCG
CCCGGCGCGCTGCCGGCCGCGCTTGCGAACGACGCGGATACGCGCTACGAGAACACGTTCACCTGCGTGCGCCGCGGCGT
GCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGTGCATCTGCTCACGGGCACGATCGTCGGCGCGGAGG
GCGAGGAAGTGTTCTGCGACGAAAACGGCCGGGTGCGCGTGCGGGTGCACGGCCTCGACCCGGCGGACCACGCGCACGCG
CAGGGCGCGGGCACCAACGACAACGCGGGCGACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCCATTTCGG
CGCATCGTTTCTGCCGCGAGTCGGCATGGAAGTCCTCCTCGGCTGTCTCGGCGGCGATCCGGACCGGTTGGTGATCATCG
GCGTGCTCGGTAACGGCGCGAATCCGCCGGCGACGTTCAGCCATGCGGGCGGCTTGCCGGGCAACCGCTACCTGTCCGGC
ATCAAGACGAAGGAGATCAAGGGGCAGCGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCAGCGCGCAACT
GGCGAGCGAGCATGCGCATTCGCAGCTCAATCTCGGATACCTGACCCAACCGCGCGAGAACGGTCATGGCAACGACCGCG
GCGAGGGCGCGGAGCTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCGCAAGGCATTCTGCTGACGACCTACGCGCGC
ACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGATTCGGTTGCTCGGCGAGTGCTCGGAGCTGTTCAAGGCGCT
GGGCGACTACGCGGGGCAGCACGGCGGGCAGGCTGCGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCCTTCAGGAACT
GGACGCCGGGCGCGGGCGGCGCCGATGCGCCGCCCGACGGCGGAGATCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGC
TCGGTGAACGTCACGCCGAAGACGCACGTGACGTATGCCGGAGAGAACATCGATCAGGTTGCGCAGCAGCACCTGCAACT
GATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAACTCTTCGCGCGGGGCGCGGGCGTGCAGGCCGTGG
CGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGATACGTTGACGGCGAATGCGCAGAAGGGCGTCAAGATCACGACG
AACGAGCACGAGGTGTTCGTGAGCGCGCCGAGGATTCGGCTCGTCGCCGAGGACGGCAGCTACCTCGAGATCGGCAACGG
CATCACGCTCGGCACGAACGGCGACATCAAGCTGCTGTCGGCGTCGCACCAGTGGGGCGGGCCGTCGACGGCGCAGGCGG
CGAAGACCGCGTTCGACAACCAGCCGACGGATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCCGGCT
GCGGCGAACAAGCCATTCCGGATCACGCTGAACGACGGGCGCGTCATCGAGGGCAAGACCGATGCGAGCGGCCTGACGGA
TCTGGTCAAGGACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAACCGAAGCTTTGA