Detailed information of effector


Summary

Effector ID EFF00109 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00080 experimental (Type ii)
Strain Francisella tularensis subsp. tularensis SCHU S4
Replicon chromosome
Sequence Protein sequence (384 a.a.); Nucleotide sequence (1152 bp)
Description IglI protein
Reference
[1] Dai S, Mohapatra NP, Schlesinger LS, et al. The acid phosphatase AcpA is secreted in vitro and in macrophages by Francisella spp. Infect Immun. 2012 Mar;80(3):1088-97. doi: 10.1128/IAI.06245-11. Epub 2011 Dec 19. PMID: 22184418
[2] Long ME, Lindemann SR, Rasmussen JA, et al. Disruption of Francisella tularensis Schu S4 iglI, iglJ, and pdpC genes results in attenuation for growth in human macrophages and in vivo virulence in mice and reveals a unique phenotype for pdpC. Infect Immun. 2013 Mar;81(3):850-61. doi: 10.1128/IAI.00822-12. Epub 2012 Dec 28. PMID: 23275090
[3] Bröms JE, Lavander M, Meyer L, et al. IglG and IglI of the Francisella pathogenicity island are important virulence determinants of Francisella tularensis LVS. Infect Immun. 2011 Sep;79(9):3683-96. doi: 10.1128/IAI.01344-10. Epub 2011 Jun 20. PMID: 21690239
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) FTL_0118 (IglI)
Coordinates (Strand) 1784240..1785391 (+)
NCBI ID 56708716
RefSeq NC_006570
Uniprot ID Q5NED0_FRATT
KEGG ID ftu:FTT_1707, ftu:FTT_1352
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-383 MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9965 - -



  Protein sequence: 384 a.a.    .

>EFF00109 NC_006570:1784240-1785391 [Francisella tularensis subsp. tularensis SCHU S4]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNLDTVDNISKII
SSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDF
KIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNF
FYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI*

  Nucleotide sequence: 1152 bp    .

>EFF00109 NC_006570:1784240-1785391 [Francisella tularensis subsp. tularensis SCHU S4]
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTAATATGCAAAT
ACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCTTAATACTACTAGAAGCATAG
ATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTAGATACGGTTGATAATATCTCTAAAATTATT
AGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAATTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGA
AAAAGGAATAAACAAATTCTTAGTCACTATGGATGCAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTACCAAATA
ACATAGATTCTATTATAGAAATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAACTTAAATTATAATTCTGATTTT
AAAATCCAACTAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATTCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGGAAAACTCTTA
TTGAAAAAATTGAAGTTTTAAAAGCTCTAGTTGAAAGTGAAAGAATATTTGAAACATCTATTGTTTATAATGATATACAA
AACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTTTCCATTATACAAGAAGATAGCTCCTTTTAT
TGGCAATATCCATAAAAACATAGACTACTACTCATCAAGTATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATT
ATAAGAGTTTTTTAGATACTCTTGAGAAAATGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTC
TTTTATGAAACATCCTCAGAGGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGA
AGAAATAGTAATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGACCCCGTAGAAAAAATTTCAAATAAAATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA