Detailed information of effector


Summary

Effector ID EFF00087 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00070 experimental (Type i1)
Strain Burkholderia mallei ATCC 23344
Replicon chromosome
Sequence Protein sequence (1008 a.a.); Nucleotide sequence (3024 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BMA_RS19580
Coordinates (Strand) 750563..753586 (-)
NCBI ID 53717363
RefSeq NC_006349
Uniprot ID A0A0H2WD12_BURMA
KEGG ID bma:BMAA0737
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.1e-73 46..349
Phage_base_V PF04717.14 1.7e-06 418..480

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1007 MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQLRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYLPATSLDAGIEADRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQAHLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYKVRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGVTGVSTALMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQNTFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSASDAQLGFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8969 - -



  Protein sequence: 1008 a.a.    .

>EFF00087 NC_006349:c753586-750563 [Burkholderia mallei ATCC 23344]
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQLRIDFAKMLSRGATLAIL
PPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGG
GYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYLPATSLDAGIEADRVQAFT
CRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRA
GRFFALSGHYREDFDGRYLVTALTHRGSQAHLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSA
IVDGEGGGKLAELDEYGQYKVRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAV
PNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLK
CSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQ
LDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGVTGVSTALMATSRTLLANVAKLQEALP
LVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAAKHAHVHASDTLLFAVPADPT
TQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQNTFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLV
ALKVDNLQQKFAKHVQHLSAVRMSASDAQLGFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAA
GCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG*

  Nucleotide sequence: 3024 bp    .

>EFF00087 NC_006349:c753586-750563 [Burkholderia mallei ATCC 23344]
ATGCCTTCGTCCCCCCGCCACGATGCGCCCGCGTCGCGCGCGAACGCCGCGCCGTCCGCGAACGCGCGACGCTTCACGTT
CGCGAGCGACGCGTACGACCCCGCGACATTCGACGTCGTCGACATCAACGGCCGCGACGCGATCTCGCAGCCGTACCGGT
TCGAGATCACGCTCGTGAGCAGGCAGTTGCGGATCGACTTCGCGAAGATGCTGAGCCGCGGGGCGACGCTCGCGATCCTG
CCGCCGTTCGGCGAGGCCGGCACCACCCGCTATGCCGGCGTGCTCGCCGAATTCGAGCAGAAGAAACGCTTTCGCGACTT
CACCGTCTATCGCGCGACGCTCGTGCCGCGCCTCTGGCGACTATCGCTGTACAAGGCGTCGGACGTCTATCTGAACGAGC
AGACGATTCCCGACATCGTCAAGCGCGTGCTGCGCGCCGCCTCGTTCGGCAGCCGCGATTTCCGCATGCGGCACGGCGGC
GGCTACCGCAAGCGCAGCTTCGTCTGCCAATACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGG
CCTCTACTACTACTTCGAGCATGACGGCCGGCACGAAACGCTCGTGATCGTCGACGACCGCCGCCATCAGCCCGGCCCCG
CCGACGATCTCGCGCTGCGCTACCTACCCGCGACCAGCCTCGACGCGGGCATCGAAGCGGACCGCGTGCAGGCGTTCACA
TGCCGGGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGACTTCAACCACCGCAAGGCGGAGCTCTCGCTCGAAGTCCG
CGAGCGCGTGGCGCGCGACGGCGTCGGCGAGCGGGTGTCGAGCGACGAGCACTTCCACACGAAGGACGAAGGGCAGCGCT
ACGCGAAGCTGCGCGCCGAGGCGCTCGTCTGCGAAGGGCGCCGATTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCC
GGCCGCTTCTTCGCGCTGTCGGGCCACTACCGCGAGGATTTCGACGGCCGCTATCTGGTGACGGCGCTCACGCATCGCGG
CTCGCAGGCACACCTGCTGTTTCCCGATCTCGACGCGCCGTTCGGCGCGACGCCGGGCGAGCCCATCTACCGCGCCGAGT
TCGAGGCGATTGCCGCCGACCTCCAGTACCGGCCGCCGCGCACGACGCCCAAGCCGCGCGCGGCGGGCGTCGTCAGCGCG
ATCGTCGACGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGCCAGTACAAGGTGCGCTTTCCGTTCGCGCA
CACCGCGCATCCGGCGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGCCCTACGCGGGCGACGACCGCGGCATGCACC
TGCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCATTCGACGGCGGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTG
CCCAACTCGTCGCACCGCAGCGTCGTCACGCGCCGCAACCCCGCCGAGCATCGCATCCTCACCGAGCACAACCAGCTCTA
CATGAAGGACGGCAGCGGCGCGGCGACGTGGCTGCACGCGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCG
ACGGCCTCGCGCTCCTCACGTCCGGCAACAAGTTCGACTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAG
TGCTCGGTGTCGATGGGCGGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGAACTTCCTGAC
GACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGAGCTTCGAGATCAACGACAGCGCATCGACACTGCTGC
AGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGGCAGGACGCGTCCGCGCTGCTGCAAAAGCAG
CTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCGTGTCGGGCCTCGCGAACGCCGGGTCCGCGGCCGCCGCCGC
GGGGCTCATCAAGGGCGGCGGCAAGCTCGCCGATCTGCCGTGGGCGGGCTTCGGCATATCCGCCGCGCAGTTCGCCGGCG
TGACCGGCGTCAGCACGGCGCTGATGGCGACCTCGCGCACGCTGCTCGCGAACGTCGCGAAGCTCCAGGAGGCGTTGCCG
CTCGTCGCCGATCTGTCGCTCGGCAAGCAGGGCATCGCGCTCGCCGCGAAGAACCTCACGCACGCGACGCGGATGTCGCT
CACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCCGGCGCGGCGGGCGCCGCGATGAGCGTCGGCAAGGGCC
GCTGGGGCGTCGAAGCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCGCGGTGCCGGCCGACCCGACG
ACCCAGTTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGACGAATGCATGAAGGACATCGCCGATCTCGAAGC
CGACATTTCGGAAAACGAAGTGCTGTCGACCGATCAGAACACGTTCGGCGTCAGCGCGCTCATCCCCACGCCGCCGTCGC
CCGCCGGCGCGCTCGCGGCGGTCGCGATCAAGGTGAAGCAAGCGAAGCTCGTCGAGCTGAAGGCCAAGCAGAAGCTCGTC
GCGCTGAAGGTCGACAACCTGCAGCAGAAGTTCGCGAAGCACGTGCAGCACCTGAGCGCCGTGCGGATGAGCGCTTCCGA
CGCGCAGCTCGGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGA
AGCTCGACGTGCGCGAAGCGAAGATCGGCGTCACGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGCAAGATCGCGGCC
GGCTGCGGCAGCGCATCGCTGAAGCTCGGCAGCGACGGCGCGATCGACGTGAGCGCGACCGACGTCAAGCTGAACGGCAC
CAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGTTCGACGGCCAACTGATCCAGCTCGGCTGA