Detailed information of effector


Summary

Effector ID EFF00086 experimental
Effector type Tse
Cognate immunity protein -
Related T6SS (Type) T6SS00070 experimental (Type i1)
Strain Burkholderia mallei ATCC 23344
Replicon chromosome
Sequence Protein sequence (408 a.a.); Nucleotide sequence (1224 bp)
Description putative deubiquitinase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BMA_RS19535
Coordinates (Strand) 736735..737958 (-)
NCBI ID 77358950
RefSeq NC_006349
Uniprot ID A0A0H2XF55_BURMA
KEGG ID bma:BMAA0729
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Big_5 PF13205.8 4.2e-09 110..208
UCH PF00443.31 5.9e-05 355..384

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-407 MRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAPAAMPTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATPEVPDSGPGQTLEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9986 pos: 20-21. LAG-CG. MRSPQRGGAALALAVASLAG



  Protein sequence: 408 a.a.    .

>EFF00086 NC_006349:c737958-736735 [Burkholderia mallei ATCC 23344]
MRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAPAAMPTASPTA
TPTASPTATAAASPSAPSTATPNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPL
SWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSAL
DDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATPEVPDSGPGQTLEVMQALRMPLYDTSSANNATNNADAI
RHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVS
IEIAIYR*

  Nucleotide sequence: 1224 bp    .

>EFF00086 NC_006349:c737958-736735 [Burkholderia mallei ATCC 23344]
ATGCGCTCGCCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCGGCGATTCGGG
CGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACCGAACTCGCCCGTCGCACCAG
CGCCCACCGCGCACGTATCGAGCGGACACACGCCTCCGGCCACGGCGCCCGCCGCGATGCCCACCGCTTCACCCACCGCG
ACGCCTACCGCTTCACCCACCGCGACGGCTGCCGCTTCGCCCTCCGCGCCATCCACTGCGACGCCCAACGCCCCGCCCGC
CGCTCCGCCGGCCGTCGTCGCCACCCGCGTCCCGCCGACGCACGCGGCGTTGCGCCGCCCGACGATCGAACTCGAATTCG
ATCGCGCGATCGAGCCGGGTTCAGTCCCACACATCGTGCTGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTG
TCGTGGCTGAGCGATCGCCGGATCGCGTTCGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCC
CGCCGGCATCAGGAGCACCACGGGCGAACGGTCGGCCCATCCGCTAACGAGCAGCTTCGATACCGCGCCCGTTACGCCGC
CGCGCGGCCTGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGGCGGTTCACTCGTCGGCGCTC
GACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCTCGAAGACTACGACGCCGCATCGGCTGATGC
ACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGCGCCACGCCGGAGGTCCCGGACAGCGGGCCGGGACAAACGC
TGGAAGTGATGCAAGCGTTGCGGATGCCGTTATATGACACGAGCAGCGCGAACAACGCAACGAACAACGCCGACGCCATA
CGTCATGCGCCGCCCAACACCAAGGCGTTCTTTCTGAACTCCTATCCACCGCTTTCCTACGCGGATCTGCCGAACCACGA
CCGGCTCGTCGCGTTCGACTACAGCACGGGCGGTCACTATGTCGCTTATGTGAAGCGGGATGGAATCTGGTATCGAATCG
ACGATGCCCAGGTCAGCGCCGTCAACGAACAGGACTTGCTTGCCCTGCCGGCGTTCAACCCCGCTAACGGCAGCGTGTCG
ATCGAAATCGCGATCTATCGATGA