Detailed information of effector


Summary

Effector ID EFF00077 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00061 experimental (Type i4b)
Strain Acinetobacter baylyi ADP1
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACIAD_RS12230
Coordinates (Strand) 2646545..2647048 (-)
NCBI ID 50085755
RefSeq NC_005966
Uniprot ID UPI00003B7B6A
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 9e-40 5..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MKDIYVQFRGKYKVDGESRDSEHKDWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMLFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEVFGLKYAAVEWTYNQQDINGSAKGAVTKKWSLSNNTASYAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9848 - -



  Protein sequence: 168 a.a.    .

>EFF00077 NC_005966:c2647048-2646545 [Acinetobacter baylyi ADP1]
MKDIYVQFRGKYKVDGESRDSEHKDWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMLFVKDLDATSPKLWEACSAG
YTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEVFGLKYAAVEWTYNQQDINGSAKGAVTKKWSLSN
NTASYAA*

  Nucleotide sequence: 504 bp    .

>EFF00077 NC_005966:c2647048-2646545 [Acinetobacter baylyi ADP1]
ATGAAAGATATATACGTTCAATTTCGAGGTAAATATAAGGTTGATGGTGAGTCACGTGATTCTGAGCACAAAGACTGGCT
TGAAGTCAACTCGTGGTCGCATAATATTCGCCAGCCAAAATCTGCAACTTCAAGTAGCGTAGGTGGTCACACTGCTGAAC
GTGTTGAGCATTCAGATATGCTTTTTGTTAAAGATTTGGATGCAACCAGCCCTAAACTGTGGGAAGCATGCTCTGCAGGT
TATACCTTTGATGAAGTACAGATCGATTTTTATCGTGCCAATGGTGATAAACGTATCAAGTACCTTCAAATCAAACTCAA
ACATGTTTTAGTTTCAAGTGTAACTCCGACTGTAAATGAAGAGGGTGTACCTACTGAAGTGTTTGGTTTGAAATATGCTG
CAGTTGAGTGGACTTATAACCAGCAAGACATTAACGGTTCTGCTAAAGGTGCTGTGACTAAAAAATGGTCTCTTTCAAAT
AACACTGCATCTTACGCTGCGTAA