Detailed information of effector


Summary

Effector ID EFF00065 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00047 experimental (Type i1)
Strain Helicobacter hepaticus ATCC 51449
Replicon chromosome
Sequence Protein sequence (170 a.a.); Nucleotide sequence (510 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) HH_RS01205
Coordinates (Strand) 234543..235052 (-)
NCBI ID 32265742
RefSeq NC_004917
Uniprot ID UPI00001AB1DE
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 7.8e-33 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-169 MAQPAYIKIEGVTQGLISSGASTQESIGNRYQAGHEDEIMAQEISHIVTVPTDTQSGQPSGQRVHRPFIFTCSLNKAVPLLYNALTKGERLNNVEVHWFRTSIGGGAEHYFTTKLEDAIITDIDLIMPNAQDTSNNNKTELFRVSLNYRKIIWEHVVAGTSGSDDWRNA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9540 - -



  Protein sequence: 170 a.a.    .

>EFF00065 NC_004917:c235052-234543 [Helicobacter hepaticus ATCC 51449]
MAQPAYIKIEGVTQGLISSGASTQESIGNRYQAGHEDEIMAQEISHIVTVPTDTQSGQPSGQRVHRPFIFTCSLNKAVPL
LYNALTKGERLNNVEVHWFRTSIGGGAEHYFTTKLEDAIITDIDLIMPNAQDTSNNNKTELFRVSLNYRKIIWEHVVAGT
SGSDDWRNA*

  Nucleotide sequence: 510 bp    .

>EFF00065 NC_004917:c235052-234543 [Helicobacter hepaticus ATCC 51449]
ATGGCGCAGCCAGCATATATTAAAATTGAAGGTGTTACACAAGGACTTATTTCTAGTGGGGCTTCTACGCAAGAGAGCAT
AGGTAATCGTTACCAAGCAGGACACGAAGATGAAATTATGGCTCAAGAGATTTCTCATATTGTAACTGTTCCCACAGATA
CACAAAGCGGACAACCATCAGGTCAAAGGGTGCATAGACCCTTTATTTTTACCTGTTCTCTCAATAAAGCTGTTCCTTTA
CTTTACAATGCCCTCACAAAGGGTGAAAGATTAAACAATGTAGAAGTACATTGGTTTAGGACATCAATAGGTGGTGGAGC
AGAACATTACTTCACTACAAAATTAGAAGATGCTATTATTACAGACATAGACCTTATTATGCCAAATGCACAAGATACAA
GCAATAATAACAAAACTGAGCTCTTTAGGGTTTCTCTTAATTATCGAAAAATTATTTGGGAACATGTTGTTGCAGGAACG
AGCGGAAGTGATGACTGGAGAAATGCTTAA